Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using APOL3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human, Mouse APOL3 Polyclonal Antibody | anti-APOL3 antibody
APOL3 Polyclonal Antibody
Gene Names
APOL3; CG121; CG12_1; APOLIII; apoL-III
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
APOL3; Polyclonal Antibody; APOL3 Polyclonal Antibody; apoL-III; APOLIII; CG121; CG12_1; anti-APOL3 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTI
Sequence Length
331
Applicable Applications for anti-APOL3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human APOL3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
DU145, A-549, BxPC-3, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using APOL3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using APOL3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-APOL3 antibody
This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-APOL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 21kDa; 36kDa; 44kDa
Observed: 38kDa
Observed: 38kDa
NCBI Official Full Name
apolipoprotein L3 isoform 2
NCBI Official Synonym Full Names
apolipoprotein L3
NCBI Official Symbol
APOL3
NCBI Official Synonym Symbols
CG121; CG12_1; APOLIII; apoL-III
NCBI Protein Information
apolipoprotein L3
UniProt Protein Name
Apolipoprotein L3
Protein Family
UniProt Gene Name
APOL3
UniProt Synonym Gene Names
ApoL-III; CG12_1
NCBI Description
This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Uniprot Description
May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
Research Articles on APOL3
Similar Products
Product Notes
The APOL3 apol3 (Catalog #AAA9133857) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOL3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's APOL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the APOL3 apol3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDSEKKRFTE EATKYFRERV SPVHLQILLT NNEAWKRFVT AAELPRDEAD ALYEALKKLR TYAAIEDEYV QQKDEQFREW FLKEFPQVKR KIQESIEKLR ALANGIEEVH RGCTISNVVS SSTGAASGIM SLAGLVLAPF TAGTSLALTA AGVGLGAASA VTGITTSIVE HSYTSSAEAE ASRLTATSID RLKVFKEVMR DITPNLLSLL NNYYEATQTI GSEIRAIRQA RARARLPVTT WRISAGSGGQ AERTI. It is sometimes possible for the material contained within the vial of "APOL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
