Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TAPBP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Rabbit TAPBP Polyclonal Antibody | anti-TAPBP antibody

TAPBP Polyclonal Antibody

Gene Names
TAPBP; TPN; TAPA; TPSN; NGS17
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
TAPBP; Polyclonal Antibody; TAPBP Polyclonal Antibody; NGS17; TAPA; TPN; TPSN; anti-TAPBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPT
Sequence Length
448
Applicable Applications for anti-TAPBP antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human TAPBP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TAPBP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TAPBP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat liver using TAPBP antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat liver using TAPBP antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human lung cancer using TAPBP antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human lung cancer using TAPBP antibody at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using TAPBP antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using TAPBP antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-TAPBP antibody
This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
Product Categories/Family for anti-TAPBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 38kDa; 43kDa; 47kDa; 53kDa
Observed: 50kDa
NCBI Official Full Name
tapasin isoform 1
NCBI Official Synonym Full Names
TAP binding protein
NCBI Official Symbol
TAPBP
NCBI Official Synonym Symbols
TPN; TAPA; TPSN; NGS17
NCBI Protein Information
tapasin
UniProt Protein Name
Tapasin
Protein Family
UniProt Gene Name
TAPBP
UniProt Synonym Gene Names
NGS17; TAPA; TPN; TPSN

NCBI Description

This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).

Research Articles on TAPBP

Similar Products

Product Notes

The TAPBP tapbp (Catalog #AAA9133400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAPBP Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAPBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the TAPBP tapbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VEDASGKGLA KRPGALLLRQ GPGEPPPRPD LDPELYLSVH DPAGALQAAF RRYPRGAPAP HCEMSRFVPL PASAKWASGL TPAQNCPRAL DGAWLMVSIS SPVLSLSSLL RPQPEPQQEP VLITMATVVL TVLTHTPAPR VRLGQDALLD LSFAYMPPTS EAASSLAPGP PPFGLEWRRQ HLGKGHLLLA ATPGLNGQMP AAQEGAVAFA AWDDDEPWGP WTGNGTFWLP T. It is sometimes possible for the material contained within the vial of "TAPBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.