Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western blot (WB) (Western blot analysis of extracts of various cell lines using OPRM1 antibody (MBS8503411).Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer : 3% nonfat dry milk in TBST.)

Rabbit anti-Mouse, Rat mu-Opioid Receptor Antibody | anti-OPRM1 antibody

mu-Opioid Receptor Antibody

Gene Names
OPRM1; MOP; MOR; LMOR; MOR1; OPRM; M-OR-1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
mu-Opioid Receptor; mu-Opioid Receptor Antibody; anti-OPRM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodiumazide, 50% glycerol, pH7.3.
Sequence
IYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSNIEQQN STRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP
Sequence Length
400
Applicable Applications for anti-OPRM1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Immunogen
Asynthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human OPRM1 (NP_000905.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thawcycles.

Western blot (WB)

(Western blot analysis of extracts of various cell lines using OPRM1 antibody (MBS8503411).Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer : 3% nonfat dry milk in TBST.)

Western blot (WB) (Western blot analysis of extracts of various cell lines using OPRM1 antibody (MBS8503411).Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer : 3% nonfat dry milk in TBST.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Theoretical molecular weight: 10-20kDa/33-55kDa
Actual molecular weight: 72kDa
NCBI Official Full Name
mu-type opioid receptor isoform MOR-1
NCBI Official Synonym Full Names
opioid receptor mu 1
NCBI Official Symbol
OPRM1
NCBI Official Synonym Symbols
MOP; MOR; LMOR; MOR1; OPRM; M-OR-1
NCBI Protein Information
mu-type opioid receptor
UniProt Protein Name
Mu-type opioid receptor
Protein Family
UniProt Gene Name
OPRM1
UniProt Synonym Gene Names
MOR1; M-OR-1; MOR-1; MOP; hMOP

NCBI Description

This gene encodes one of at least three opioid receptors in humans; the mu opioid receptor (MOR). The MOR is the principal target of endogenous opioid peptides and opioid analgesic agents such as beta-endorphin and enkephalins. The MOR also has an important role in dependence to other drugs of abuse, such as nicotine, cocaine, and alcohol via its modulation of the dopamine system. The NM_001008503.2:c.118A>G allele has been associated with opioid and alcohol addiction and variations in pain sensitivity but evidence for it having a causal role is conflicting. Multiple transcript variants encoding different isoforms have been found for this gene. Though the canonical MOR belongs to the superfamily of 7-transmembrane-spanning G-protein-coupled receptors some isoforms of this gene have only 6 transmembrane domains. [provided by RefSeq, Oct 2013]

Uniprot Description

Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone (PubMed:7905839, PubMed:7957926, PubMed:7891175, PubMed:12589820, PubMed:9689128). Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors (PubMed:7905839). The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15 (PubMed:12068084). They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling whereas morphine induces only low desensitization and endocytosis. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 12 couples to GNAS and is proposed to be involved in excitatory effects (PubMed:20525224). Isoform 16 and isoform 17 do not bind agonists but may act through oligomerization with binding-competent OPRM1 isoforms and reduce their ligand binding activity (PubMed:16580639).

Research Articles on OPRM1

Similar Products

Product Notes

The OPRM1 oprm1 (Catalog #AAA8503411) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The mu-Opioid Receptor Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's mu-Opioid Receptor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:1000. Researchers should empirically determine the suitability of the OPRM1 oprm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IYVIIKALVT IPETTFQTVS WHFCIALGYT NSCLNPVLYA FLDENFKRCF REFCIPTSSN IEQQN STRIRQNTRD HPSTANTVDR TNHQLENLEA ETAPLP. It is sometimes possible for the material contained within the vial of "mu-Opioid Receptor, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.