Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit KLHL7 Polyclonal Antibody | anti-KLHL7 antibody

KLHL7 antibody

Gene Names
KLHL7; KLHL6; SBBI26
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KLHL7; Polyclonal Antibody; KLHL7 antibody; Polyclonal KLHL7; Anti-KLHL7; KLHL 7; KLHL-7; SBBI26; KLHL6; Kelch-Like 7; anti-KLHL7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
166
Applicable Applications for anti-KLHL7 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-KLHL7 antibody
Rabbit polyclonal KLHL7 antibody
Product Categories/Family for anti-KLHL7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
kelch-like protein 7 isoform 3
NCBI Official Synonym Full Names
kelch-like family member 7
NCBI Official Symbol
KLHL7
NCBI Official Synonym Symbols
KLHL6; SBBI26
NCBI Protein Information
kelch-like protein 7
UniProt Protein Name
Kelch-like protein 7
Protein Family
UniProt Gene Name
KLHL7
UniProt Entry Name
KLHL7_HUMAN

NCBI Description

This gene encodes a BTB-Kelch-related protein. The encoded protein may be involved in protein degradation. Mutations in this gene have been associated with retinitis pigmentosa 42. [provided by RefSeq, Feb 2010]

Uniprot Description

KLHL7: Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex. The BCR(KLHL7) complex acts by mediating ubiquitination and subsequent degradation of substrate proteins. Probably mediates 'Lys-48'-linked ubiquitination. Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). A retinal dystrophy belonging to the group of pigmentary retinopathies. RP is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: nucleoplasm; cytoplasm; nucleolus; plasma membrane; nucleus

Molecular Function: protein homodimerization activity

Biological Process: protein ubiquitination

Disease: Retinitis Pigmentosa 42

Research Articles on KLHL7

Similar Products

Product Notes

The KLHL7 klhl7 (Catalog #AAA839225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL7 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KLHL7 klhl7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLHL7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.