Rabbit RNF186 Polyclonal Antibody | anti-RNF186 antibody
RNF186 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
RNF186; Polyclonal Antibody; RNF186 antibody; Polyclonal RNF186; Anti-RNF186; RNF-186; Ring Finger Protein 186; FLJ20225; RNF 186; RP11-91K11.1; anti-RNF186 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
RNF186 antibody was raised against the N terminal of RNF186
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF186 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
227
Applicable Applications for anti-RNF186 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The specific function of RNF186 is not yet known.
Cross-Reactivity
Human
Immunogen
RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-RNF186 antibody
Rabbit polyclonal RNF186 antibody raised against the N terminal of RNF186
Product Categories/Family for anti-RNF186 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24 kDa (MW of target protein)
NCBI Official Full Name
RING finger protein 186
NCBI Official Synonym Full Names
ring finger protein 186
NCBI Official Symbol
RNF186
NCBI Protein Information
RING finger protein 186
UniProt Protein Name
RING finger protein 186
Protein Family
UniProt Gene Name
RNF186
UniProt Entry Name
RN186_HUMAN
Uniprot Description
RNF186:
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 1p36.13
Cellular Component: integral to membrane
Molecular Function: zinc ion binding
Research Articles on RNF186
Similar Products
Product Notes
The RNF186 rnf186 (Catalog #AAA839133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RNF186 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RNF186 rnf186 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF186, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
