Tyrosine-protein kinase JAK3 Recombinant Protein | Jak3 recombinant protein

Recombinant Mouse Tyrosine-protein kinase JAK3

Cat. Num. AAA1359679

• Gene Names: Jak3; fae; wil
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tyrosine-protein kinase JAK3; Recombinant Mouse Tyrosine-protein kinase JAK3; Janus kinase 3; JAK-3; Jak3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 818-1100. partial
• Sequence: LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Jak3 recombinant protein

Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hatopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.

References

JAK3 a novel JAK kinase associated with terminal differentiation of hematopoietic cells.Rane S.G., Reddy E.P.Oncogene 9:2415-2423(1994) Murine JAK3 is preferentially expressed in hematopoietic tissues and lymphocyte precursor cells.Gurniak C.B., Berg L.J.Blood 87:3151-3160(1996) Involvement of the Jak-3 Janus kinase in signalling by interleukins 2 and 4 in lymphoid and myeloid cells.Witthuhn B.A., Silvennoinen O., Miura O., Lai K.S., Cwik C., Liu E.T., Ihle J.N.Nature 370:153-157(1994) Defects in B lymphocyte maturation and T lymphocyte activation in mice lacking Jak3.Thomis D.C., Gurniak C.B., Tivol E., Sharpe A.H., Berg L.J.Science 270:794-797(1995) Defective lymphoid development in mice lacking Jak3.Nosaka T., van Deursen J.M., Tripp R.A., Thierfelder W.E., Witthuhn B.A., McMickle A.P., Doherty P.C., Grosveld G.C., Ihle J.N.Science 270:800-802(1995) Peripheral expression of Jak3 is required to maintain T lymphocyte function.Thomis D.C., Berg L.J.J. Exp. Med. 185:197-206(1997) T cell development and activation in Jak3-deficient mice.Baird A.M., Thomis D.C., Berg L.J.J. Leukoc. Biol. 63:669-677(1998) A novel protein MAJN binds to Jak3 and inhibits apoptosis induced by IL-2 deprival.Ji H., Zhai Q., Zhu J., Yan M., Sun L., Liu X., Zheng Z.Biochem. Biophys. Res. Commun. 270:267-271(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 300192999
• NCBI GeneID: 16453
• NCBI Accession #: NP_001177759.1
• NCBI GenBank Nucleotide #: NM_001190830.1
• UniProt Accession #: Q62137; Q0D2M8; Q61746; Q61747; Q8BTY6; Q8BYU2; A2RRI3
• Molecular Weight: 34.2 kDa
• NCBI Official Full Name: tyrosine-protein kinase JAK3
• NCBI Official Synonym Full Names: Janus kinase 3
• NCBI Official Symbol: Jak3
• NCBI Official Synonym Symbols: fae; wil
• NCBI Protein Information: tyrosine-protein kinase JAK3
• UniProt Protein Name: Tyrosine-protein kinase JAK3
• Protein Family: Tyrosine-protein kinase
• UniProt Gene Name: Jak3
• UniProt Synonym Gene Names: JAK-3
• UniProt Entry Name: JAK3_MOUSE

Uniprot Description

JAK3: a non-receptor tyrosine-kinase of the Jak family expressed predominantly in immune cells. Mediates signal transduction via the common gamma-chain of cytokine receptors, including IL-2, -4, -7, -9, and -15. Interacts with members of the STAT (signal transduction and activators of transcription) family. Interacts with STAM2 and SHB. Contains two protein kinase domains. Mutations that abrogate JAK3 function cause an autosomal SCID (severe combined immunodeficiency disease). Inhibitor: R017s for organ transplants. Three differentially spliced isoforms have been described.

Protein type: Kinase, protein; Protein kinase, TK; EC 2.7.10.2; Protein kinase, tyrosine (non-receptor); TK group; JakA family

Cellular Component: cytoplasm; cytoskeleton; cytosol; extrinsic to internal side of plasma membrane; intracellular; membrane

Molecular Function: ATP binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding; protein kinase activity; protein phosphatase binding; protein-tyrosine kinase activity; receptor binding; transferase activity

Biological Process: adaptive immune response; B cell differentiation; cell migration; cytokine and chemokine mediated signaling pathway; elevation of cytosolic calcium ion concentration; enzyme linked receptor protein signaling pathway; immune system process; innate immune response; lymph node development; negative regulation of dendritic cell cytokine production; negative regulation of FasL biosynthetic process; negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; negative regulation of T cell activation; negative regulation of T-helper 1 cell differentiation; peptidyl-tyrosine phosphorylation; phosphorylation; positive regulation of activated T cell proliferation; positive regulation of calcium ion transport; positive regulation of immune response; positive regulation of T cell proliferation; positive regulation of transcription from RNA polymerase II promoter; protein amino acid autophosphorylation; protein amino acid phosphorylation; T cell homeostasis; transmembrane receptor protein tyrosine kinase signaling pathway; tyrosine phosphorylation of Stat5 protein