Western Blot (WB)
(IQCK antibody (MBS838844) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Rat IQCK Polyclonal Antibody | anti-IQCK antibody
IQCK antibody
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
IQCK; Polyclonal Antibody; IQCK antibody; Polyclonal IQCK; Anti-IQCK; MGC35048; FLJ20115; FLJ36575; Iq Motif Containing K; anti-IQCK antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
IQCK antibody was raised against the middle region of IQCK
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IQCK antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
77
Applicable Applications for anti-IQCK antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of IQC protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Rat
Immunogen
IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(IQCK antibody (MBS838844) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(IQCK antibody (MBS838844) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-IQCK antibody
Rabbit polyclonal IQCK antibody raised against the middle region of IQCK
Product Categories/Family for anti-IQCK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
IQCK protein, partial
NCBI Official Synonym Full Names
IQ motif containing K
NCBI Official Symbol
IQCK
NCBI Protein Information
IQ domain-containing protein K
UniProt Protein Name
IQ domain-containing protein K
Protein Family
UniProt Gene Name
IQCK
UniProt Entry Name
IQCK_HUMAN
NCBI Description
This gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-wide association study. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Uniprot Description
IQCK: 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 16p12.3
Research Articles on IQCK
Similar Products
Product Notes
The IQCK iqck (Catalog #AAA838844) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IQCK antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IQCK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the IQCK iqck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IQCK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
