Reactive oxygen species modulator 1 (ROMO1) Recombinant Protein | ROMO1 recombinant protein

Recombinant Human Reactive oxygen species modulator 1 (ROMO1)

• Gene Names: ROMO1; MTGM; MTGMP; C20orf52; bA353C18.2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Reactive oxygen species modulator 1 (ROMO1); Recombinant Human Reactive oxygen species modulator 1 (ROMO1); Recombinant Reactive oxygen species modulator 1 (ROMO1); Reactive oxygen species modulator 1; ROS modulator 1; Epididymis tissue protein Li 175 Glyrichin Mitochondrial targeting GxxxG motif protein; MTGM Protein MGR2 homolog; ROMO1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-79
• Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
• Sequence Length: 79

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 18152785
• NCBI GeneID: 140823
• NCBI Accession #: NP_542786.1
• NCBI GenBank Nucleotide #: NM_080748.2
• UniProt Accession #: P60602; Q3MHD5; Q5QP16; Q9CQ98; Q9H1N2; A7M872; E1P5R9; E9KL28
• Molecular Weight: 8,183 Da
• NCBI Official Full Name: reactive oxygen species modulator 1
• NCBI Official Synonym Full Names: reactive oxygen species modulator 1
• NCBI Official Symbol: ROMO1
• NCBI Official Synonym Symbols: MTGM; MTGMP; C20orf52; bA353C18.2
• NCBI Protein Information: reactive oxygen species modulator 1; glyrichin; ROS modulator 1; protein MGR2 homolog; epididymis tissue protein Li 175; mitochondrial targeting GXXXG protein; mitochondrial targeting GxxxG motif protein
• UniProt Protein Name: Reactive oxygen species modulator 1
• Protein Family: Reactive oxygen species modulator
• UniProt Gene Name: ROMO1
• UniProt Synonym Gene Names: C20orf52; ROS modulator 1; MTGM
• UniProt Entry Name: ROMO1_HUMAN

NCBI Description

The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014]

Uniprot Description

Function: Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation. Ref.1 Ref.6 Ref.7 Ref.8 Ref.9 Ref.11Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage. Ref.1 Ref.6 Ref.7 Ref.8 Ref.9 Ref.11

Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein Ref.1 Ref.6.

Tissue specificity: Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line. Highly expressed in brain tumors. Ref.1 Ref.6

Developmental stage: Expression increases in senescent cells. Ref.9

Induction: By the anticancer drug fluorouracil (5FU). Ref.7

Miscellaneous: Enforced expression in IMR-90 cells leads to increased levels of ROS and induces premature cell senescence and nuclear DNA damage.

Sequence similarities: Belongs to the MGR2 family.