Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TCAP Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit TCAP Polyclonal Antibody | anti-TCAP antibody

TCAP antibody - N-terminal region

Gene Names
TCAP; TELE; CMD1N; CMH25; T-cap; LGMD2G; LGMDR7; telethonin
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCAP; Polyclonal Antibody; TCAP antibody - N-terminal region; anti-TCAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQR
Sequence Length
167
Applicable Applications for anti-TCAP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TCAP Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-TCAP Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-TCAP antibody
This is a rabbit polyclonal antibody against TCAP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TCAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
telethonin
NCBI Official Synonym Full Names
titin-cap
NCBI Official Symbol
TCAP
NCBI Official Synonym Symbols
TELE; CMD1N; CMH25; T-cap; LGMD2G; LGMDR7; telethonin
NCBI Protein Information
telethonin
UniProt Protein Name
Telethonin
Protein Family
UniProt Gene Name
TCAP
UniProt Entry Name
TELT_HUMAN

NCBI Description

Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. [provided by RefSeq, Jul 2008]

Uniprot Description

Telethonin: a muscle assembly regulating factor that interacts with the giant kinase titin. Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. Telethonin is found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: I band; Z disc; cytosol

Molecular Function: protein binding, bridging; protein binding; structural constituent of muscle; titin binding; FATZ binding

Biological Process: adult heart development; cardiac muscle hypertrophy; skeletal muscle contraction; somitogenesis; muscle thin filament assembly; detection of mechanical stimulus; cardiac myofibril assembly; sarcomere organization; muscle filament sliding; muscle thick filament assembly; cardiac muscle fiber development; sarcomerogenesis; cardiac muscle morphogensis; protein complex assembly; otic vesicle formation; cardiac muscle contraction

Disease: Muscular Dystrophy, Limb-girdle, Type 2g; Cardiomyopathy, Dilated, 1n

Research Articles on TCAP

Similar Products

Product Notes

The TCAP tcap (Catalog #AAA3208931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCAP antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCAP tcap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSLHEEDTQR HETYHQQGQC QVLVQRSPWL MMRMGILGRG LQEYQLPYQR. It is sometimes possible for the material contained within the vial of "TCAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.