Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aquaporin-2 (AQP2) Recombinant Protein | AQP2 recombinant protein

Recombinant Dog Aquaporin-2 (AQP2)

Gene Names
AQP2; AQP-2; AQP-CD; WCH-CD
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aquaporin-2 (AQP2); Recombinant Dog Aquaporin-2 (AQP2); Recombinant Aquaporin-2 (AQP2); Aquaporin-2; AQP-2; ADH water channel Aquaporin-CD; AQP-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct; AQP2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-109
Sequence
SVAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPPHVRG
Sequence Length
109
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11,196 Da
NCBI Official Full Name
Aquaporin-2
NCBI Official Symbol
AQP2
NCBI Official Synonym Symbols
AQP-2; AQP-CD; WCH-CD
NCBI Protein Information
aquaporin-2; aquaporin 2 (collecting duct); Aquaporin-2; aquaporin-CD; ADH water channel; collecting duct water channel protein; water channel protein for renal collecting duct
UniProt Protein Name
Aquaporin-2
UniProt Gene Name
AQP2
UniProt Synonym Gene Names
AQP-2; AQP-CD
UniProt Entry Name
AQP2_CANFA

Uniprot Description

Function: Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Subcellular location: Apical cell membrane; Multi-pass membrane protein

By similarity. Basolateral cell membrane; Multi-pass membrane protein

By similarity. Cytoplasmic vesicle membrane; Multi-pass membrane protein

By similarity. Golgi apparatus › trans-Golgi network membrane; Multi-pass membrane protein

By similarity. Note: Shuttles from vesicles to the apical membrane. Vasopressin-regulated phosphorylation is required for translocation to the apical cell membrane. PLEKHA8/FAPP2 is required to transport AQP2 from the TGN to sites where AQP2 is phosphorylated

By similarity.

Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).

Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]

Research Articles on AQP2

Similar Products

Product Notes

The AQP2 aqp2 (Catalog #AAA717466) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-109. The amino acid sequence is listed below: SVAFSRAVFA EFLATLLFVF FGLGSALNWP QALPSVLQIA MAFGLGIGTL VQALGHVSGA HINPAVTVAC LVGCHVSFLR AAFYVAAQLL GAVAGAALLH EITPPHVRG. It is sometimes possible for the material contained within the vial of "Aquaporin-2 (AQP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.