Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

lin-28 homolog A (LIN28A) Recombinant Protein | LIN28A recombinant protein

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Gene Names
LIN28A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
lin-28 homolog A (LIN28A); Recombinant Human Protein lin-28 homolog A (LIN28A); partial; LIN28A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
113-209aa, Partial
Sequence
GGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Species
Human
Tag
N-terminal 6xHis-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 65%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,743 Da
NCBI Official Full Name
protein lin-28 homolog A
NCBI Official Synonym Full Names
lin-28 homolog A (C. elegans)
NCBI Official Symbol
LIN28A
NCBI Official Synonym Symbols
CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A
NCBI Protein Information
protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1
UniProt Protein Name
Protein lin-28 homolog A
Protein Family
UniProt Gene Name
LIN28A
UniProt Synonym Gene Names
CSDD1; LIN28; ZCCHC1; Lin-28A
UniProt Entry Name
LN28A_HUMAN

Uniprot Description

LIN28A: Acts as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let- 7), a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminal uridylation of pre-let-7. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre- let-7 in embryonic stem (ES) cells contributes to the maintenance of ES cells. In contrast, LIN28A down-regulation in neural stem cells by miR-125, allows the processing of pre-let-7. Specifically recognizes the 5'-GGAG-3' motif in the terminal loop of pre-let-7. Also recognizes and binds non pre-let-7 pre-miRNAs that contain the 5'-GGAG-3' motif in the terminal loop, leading to their terminal uridylation and subsequent degradation. Monomer. During skeletal muscle differentiation, associated with translation initiation complexes in the polysomal compartment. Directly interacts with EIF3S2. Interaction with NCL is RNA-dependent. Interacts with ZCCHC11/TUT4. Can be negatively regulated by the interaction of microRNAs miR-125a and miR-125b with at least two miRNA responsive elements (miREs) in the 3'-UTR of this gene. These interactions may reduce both translation efficiency and mRNA abundance. Negatively regulated by retinoic acid. Expressed in embryonic stem cells (ES cells), placenta and testis. Belongs to the lin-28 family.

Protein type: Translation; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: stress granule; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: mRNA binding; protein binding; miRNA binding; DNA binding; zinc ion binding; RNA binding; translation initiation factor binding

Biological Process: positive regulation of translation; regulation of transcription, DNA-dependent; pre-microRNA processing; somatic stem cell maintenance; stem cell maintenance; positive regulation of neuron differentiation; RNA 3'-end processing; germ cell development; negative regulation of glial cell differentiation

Research Articles on LIN28A

Similar Products

Product Notes

The LIN28A lin28a (Catalog #AAA7137048) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 113-209aa, Partial. The amino acid sequence is listed below: GGVFCIGSER RPKGKSMQKR RSKGDRCYNC GGLDHHAKEC KLPPQPKKCH FCQSISHMVA SCPLKAQQGP SAQGKPTYFR EEEEEIHSPT LLPEAQN. It is sometimes possible for the material contained within the vial of "lin-28 homolog A (LIN28A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.