T-cell antigen CD7 (CD7) Recombinant Protein | CD7 recombinant protein

Recombinant Human T-cell antigen CD7 (CD7), partial

Cat. Num. AAA7135746

• Gene Names: CD7; GP40; TP41; Tp40; LEU-9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell antigen CD7 (CD7); Recombinant Human T-cell antigen CD7 (CD7); partial; GP40 (T-cell leukemia antigen); (T-cell surface antigen Leu-9); (TP41); (CD7); CD7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 26-180aa; Partial
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Sequence Length: 240

• Species: Human
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for CD7 recombinant protein

Immunology

References

"Loss of CD7, independent of galectin-3 expression, implies a worse prognosis in adult T-cell leukaemia/lymphoma."
Liu T.Y., Chen C.Y., Tien H.F., Lin C.W.Histopathology 54:214-220(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 5453613
• NCBI GeneID: 924
• NCBI Accession #: NP_006128.1
• NCBI GenBank Nucleotide #: NP_006128.1
• UniProt Accession #: P09564
• Molecular Weight: 21.5
• NCBI Official Full Name: T-cell antigen CD7
• NCBI Official Synonym Full Names: CD7 molecule
• NCBI Official Symbol: CD7
• NCBI Official Synonym Symbols: GP40; TP41; Tp40; LEU-9
• NCBI Protein Information: T-cell antigen CD7
• UniProt Protein Name: T-cell antigen CD7
• Protein Family: T-cell antigen
• UniProt Gene Name: CD7
• UniProt Entry Name: CD7_HUMAN

NCBI Description

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]

Uniprot Description

CD7: Not yet known.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 17q25.2-q25.3

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: receptor activity

Biological Process: T cell activation; homeostasis of number of cells within a tissue; immune response; transmembrane receptor protein tyrosine kinase signaling pathway