E3 Ubiquitin-Protein Ligase Pellino Homolog 1 (PELI1) Recombinant Protein | PELI1 recombinant protein

Recombinant Human E3 Ubiquitin-Protein Ligase Pellino Homolog 1 (PELI1)

Cat. Num. AAA7115332

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 Ubiquitin-Protein Ligase Pellino Homolog 1 (PELI1); Recombinant Human E3 Ubiquitin-Protein Ligase Pellino Homolog 1 (PELI1); Pellino-related intracellular-signaling molecule; RING-type E3 ubiquitin transferase pellino homolog 1; Pellino-1; PRISM; PELI1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-418aa; Full Length
• Sequence: MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
• Sequence Length: 418

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for PELI1 recombinant protein

E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation. Mediates 'Lys-48'-linked polyubiquitination of RIPK3 leading to its subsequent proteasome-dependent degradation; preferentially recognizes and mediates the degradation of the 'Thr-182' phosphorylated form of RIPK3. Negatively regulates necroptosis by reducing RIPK3 expression. Mediates 'Lys-63'-linked ubiquitination of RIPK1.

Product Categories/Family for PELI1 recombinant protein

Signal Transduction

References

"Smad6 negatively regulates interleukin 1-receptor-Toll-like receptor signaling through direct interaction with the adaptor Pellino-1." Choi K.C., Lee Y.S., Lim S., Choi H.K., Lee C.H., Lee E.K., Hong S., Kim I.H., Kim S.J., Park S.H. Nat. Immunol. 7:1057-1065(2006).

NCBI and Uniprot Product Information

• NCBI GI #: 11037063
• NCBI GeneID: 57162
• NCBI Accession #: NP_065702
• NCBI GenBank Nucleotide #: NM_020651.4
• UniProt Accession #: Q96FA3
• Molecular Weight: 50.4 kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase pellino homolog 1
• NCBI Official Synonym Full Names: pellino E3 ubiquitin protein ligase 1
• NCBI Official Symbol: PELI1
• NCBI Protein Information: E3 ubiquitin-protein ligase pellino homolog 1
• UniProt Protein Name: E3 ubiquitin-protein ligase pellino homolog 1
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: PELI1
• UniProt Synonym Gene Names: PRISM; Pellino-1
• UniProt Entry Name: PELI1_HUMAN

Uniprot Description

PELI1: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation. Found in a complex containing TRAF6, IRAK1 and IRAK4. Interacts with MAP3K7. Belongs to the pellino family.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Adaptor/scaffold; Ubiquitin conjugating system; Ligase; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: cytosol; nucleus

Molecular Function: protein binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: positive regulation of cytokine production; positive regulation of toll-like receptor 3 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to dsRNA; positive regulation of toll-like receptor 4 signaling pathway; response to lipopolysaccharide; Toll signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; negative regulation of T cell proliferation; positive regulation of protein ubiquitination; inhibition of NF-kappaB transcription factor; positive regulation of B cell proliferation; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway