Golgi Membrane Protein 1 (GOLM1) Recombinant Protein | GOLM1 recombinant protein
Recombinant Human Golgi Membrane Protein 1 (GOLM1), Partial
Gene Names
GOLM1; GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi Membrane Protein 1 (GOLM1); Recombinant Human Golgi Membrane Protein 1 (GOLM1); Partial; Golgi membrane protein GP73; Golgi phosphoprotein 2; GOLM1 recombinant protein
Host
E Coli
Specificity
Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocytes-derived syncytial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-401aa; Partial
Sequence
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Sequence Length
401
Species
Human
Tag
N-terminal GST-tagged
Subcellular Location
Golgi Apparatus, Cis-Golgi Network Membrane, Single-Pass Type II Membrane Protein
Protein Families
GOLM1/CASC4 family
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for GOLM1 recombinant protein
Unknown. Cellular response protein to viral infection.
Product Categories/Family for GOLM1 recombinant protein
References
GP73, a novel Golgi-localized protein upregulated by viral infection.Kladney R.D., Bulla G.A., Guo L., Mason A.L., Tollefson A.E., Simon D.J., Koutoubi Z., Fimmel C.J.Gene 249:53-65(2000).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
68.6 kDa
NCBI Official Full Name
Golgi membrane protein 1
NCBI Official Synonym Full Names
golgi membrane protein 1
NCBI Official Symbol
GOLM1
NCBI Official Synonym Symbols
GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
NCBI Protein Information
Golgi membrane protein 1
UniProt Protein Name
Golgi membrane protein 1
Protein Family
UniProt Gene Name
GOLM1
UniProt Synonym Gene Names
C9orf155; GOLPH2
UniProt Entry Name
GOLM1_HUMAN
NCBI Description
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009]
Uniprot Description
GOLM1: Unknown. Cellular response protein to viral infection. Belongs to the GOLM1/CASC4 family. 2 isoforms of the human protein are produced by alternative initiation.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 9q21.33
Cellular Component: Golgi apparatus; extracellular space; integral to plasma membrane
Molecular Function: protein binding
Biological Process: regulation of lipid metabolic process; nuclear organization and biogenesis
Research Articles on GOLM1
Similar Products
Product Notes
The GOLM1 golm1 (Catalog #AAA7115212) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-401aa; Partial. The amino acid sequence is listed below: SSRSVDLQTR IMELEGRVRR AAAERGAVEL KKNEFQGELE KQREQLDKIQ SSHNFQLESV NKLYQDEKAV LVNNITTGER LIRVLQDQLK TLQRNYGRLQ QDVLQFQKNQ TNLERKFSYD LSQCINQMKE VKEQCEERIE EVTKKGNEAV ASRDLSENND QRQQLQALSE PQPRLQAAGL PHTEVPQGKG NVLGNSKSQT PAPSSEVVLD SKRQVEKEET NEIQVVNEEP QRDRLPQEPG REQVVEDRPV GGRGFGGAGE LGQTPQVQAA LSVSQENPEM EGPERDQLVI PDGQEEEQEA AGEGRNQQKL RGEDDYNMDE NEAESETDKQ AALAGNDRNI DVFNVEDQKR DTINLLDQRE KRNHTL. It is sometimes possible for the material contained within the vial of "Golgi Membrane Protein 1 (GOLM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
