Golgi membrane protein 1 Recombinant Protein | GOLM1 recombinant protein

Recombinant Human Golgi membrane protein 1

Cat. Num. AAA1265441

• Gene Names: GOLM1; GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Golgi membrane protein 1; Recombinant Human Golgi membrane protein 1; Golgi membrane protein GP73; Golgi phosphoprotein 2; GOLM1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 36-401aa; Partial
• Sequence: SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
• Sequence Length: 401

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GOLM1 recombinant protein

Unknown. Cellular response protein to viral infection.

Product Categories/Family for GOLM1 recombinant protein

Signal Transduction

References

GP73, a novel Golgi-localized protein upregulated by viral infection.Kladney R.D., Bulla G.A., Guo L., Mason A.L., Tollefson A.E., Simon D.J., Koutoubi Z., Fimmel C.J.Gene 249:53-65(2000) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) Dymeclin, the gene underlying Dyggve-Melchior-Clausen syndrome, encodes a protein integral to extracellular matrix and Golgi organization and is associated with protein secretion pathways critical in bone development.Denais C., Dent C.L., Southgate L., Hoyle J., Dafou D., Trembath R.C., Machado R.D.Hum. Mutat. 32:231-239(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 29550838
• NCBI GeneID: 51280
• NCBI Accession #: NP_057632.2
• NCBI GenBank Nucleotide #: NM_016548.3
• UniProt Accession #: Q8NBJ4; Q6IAF4; Q9NRB9
• Molecular Weight: 41.6 kDa
• NCBI Official Full Name: Golgi membrane protein 1
• NCBI Official Synonym Full Names: golgi membrane protein 1
• NCBI Official Symbol: GOLM1
• NCBI Official Synonym Symbols: GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
• NCBI Protein Information: Golgi membrane protein 1
• UniProt Protein Name: Golgi membrane protein 1
• Protein Family: Golgi membrane protein
• UniProt Gene Name: GOLM1
• UniProt Synonym Gene Names: C9orf155; GOLPH2
• UniProt Entry Name: GOLM1_HUMAN

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

GOLM1: Unknown. Cellular response protein to viral infection. Belongs to the GOLM1/CASC4 family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q21.33

Cellular Component: extracellular space; Golgi apparatus; integral to plasma membrane

Molecular Function: protein binding

Biological Process: nuclear organization and biogenesis; regulation of lipid metabolic process