Kit Ligand (Kitlg) Active Protein | Kitlg active protein

Recombinant Mouse Kit Ligand (Kitlg), Partial

Cat. Num. AAA7115004

• Gene Names: Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kit Ligand (Kitlg); Recombinant Mouse Kit Ligand (Kitlg); Partial; Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; Kitlg active protein

• Host: E Coli
• Specificity: Expressed in the cochlea.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 26-189aa; Partial
• Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
• Sequence Length: 273

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by the dose-dependent stimulation of TF-1 cells is less than 10 ng/ml.
• Subcellular Location: Isoform 1: Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Cytoplasm, cytoskeleton, Cell Membrane, Single-Pass Type I Membrane Protein, Cytoplasm, cytoskeleton, Cell Projection, lamellipodium, Cell Projection, filopodium, SUBCELLULAR LOCATION: Soluble KIT ligand: Secreted
• Protein Families: SCF Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Kitlg active protein

Relevance: Mouse stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.

Function: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Product Categories/Family for Kitlg active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 7305267
• NCBI GeneID: 17311
• NCBI Accession #: NP_038626.1
• NCBI GenBank Nucleotide #: NM_013598.3
• UniProt Accession #: P20826
• Molecular Weight: 18.4 kDa
• NCBI Official Full Name: kit ligand isoform 1
• NCBI Official Synonym Full Names: kit ligand
• NCBI Official Symbol: Kitl
• NCBI Official Synonym Symbols: Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• NCBI Protein Information: kit ligand
• UniProt Protein Name: Kit ligand
• Protein Family: Kit ligand
• UniProt Gene Name: Kitlg
• UniProt Synonym Gene Names: Kitl; Mgf; Sl; Slf; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_MOUSE

Uniprot Description

SCF: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. Homodimer, non-covalently linked (Probable). Heterotetramer with KIT, binding two KIT molecules; thereby mediates KIT dimerization and subsequent activation by autophosphorylation. Belongs to the SCF family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extracellular space; cytoskeleton; membrane; cytoplasm; extracellular region; integral to membrane; plasma membrane

Molecular Function: protein binding; growth factor activity; cytokine activity; stem cell factor receptor binding

Biological Process: embryonic hemopoiesis; positive regulation of leukocyte migration; germ cell programmed cell death; germ cell development; positive regulation of MAP kinase activity; positive regulation of peptidyl-tyrosine phosphorylation; ovarian follicle development; negative regulation of mast cell apoptosis; positive regulation of melanocyte differentiation; positive regulation of cell proliferation; positive regulation of myeloid leukocyte differentiation; positive regulation of Ras protein signal transduction; cell adhesion; neural crest cell migration; positive regulation of DNA replication; negative regulation of apoptosis