Fibroblast Growth Factor 2 (Fgf2) Active Protein | Fgf2 active protein

Recombinant Mouse Fibroblast Growth Factor 2 (Fgf2)

Cat. Num. AAA7115003

• Gene Names: Fgf2; Fgfb; bFGF; Fgf-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor 2 (Fgf2); Recombinant Mouse Fibroblast Growth Factor 2 (Fgf2); Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2; Fgf2 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 400 mM NaCl, pH 7.0
• Sequence Positions: 1-154aa; Full Length
• Sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Sequence Length: 154

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2 ng/ml.
• Subcellular Location: Secreted, Nucleus
• Protein Families: Heparin-Binding Growth Factors Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Fgf2 active protein

Relevance: FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.

Product Categories/Family for Fgf2 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 7106315
• NCBI GeneID: 14173
• NCBI Accession #: NP_032032.1
• NCBI GenBank Nucleotide #: NM_008006.2
• UniProt Accession #: P15655
• Molecular Weight: 17.15 kDa
• NCBI Official Full Name: fibroblast growth factor 2
• NCBI Official Synonym Full Names: fibroblast growth factor 2
• NCBI Official Symbol: Fgf2
• NCBI Official Synonym Symbols: Fgfb; bFGF; Fgf-2
• NCBI Protein Information: fibroblast growth factor 2
• UniProt Protein Name: Fibroblast growth factor 2
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: Fgf2
• UniProt Synonym Gene Names: Fgf-2; FGF-2; bFGF; HBGF-2
• UniProt Entry Name: FGF2_MOUSE

Uniprot Description

FGF2: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Interacts with CSPG4, FGFBP1 and TEC. Found in a complex with FGFBP1, FGF1 and FGF2. Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non- cancerous liver tissue. Belongs to the heparin-binding growth factors family. 4 isoforms of the human protein are produced by alternative initiation.

Protein type: Motility/polarity/chemotaxis; Activator

Cellular Component: extracellular space; cytoplasm; extracellular region; cytosol; nucleus

Molecular Function: heparin binding; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; growth factor activity; cytokine activity; fibroblast growth factor receptor binding; chemoattractant activity; receptor binding

Biological Process: wound healing; activation of MAPKK activity; regulation of cell cycle; positive regulation of smooth muscle cell proliferation; positive regulation of transcription, DNA-dependent; multicellular organismal development; adrenocorticotropin hormone secreting cell differentiation; cardiac muscle cell proliferation; thyroid stimulating hormone secreting cell differentiation; hyaluronan catabolic process; growth factor dependent regulation of satellite cell proliferation; positive regulation of MAP kinase activity; embryonic development ending in birth or egg hatching; negative regulation of cell proliferation; glial cell differentiation; substantia nigra development; positive chemotaxis; induction of an organ; positive regulation of cell proliferation; regulation of retinal cell programmed cell death; angiogenesis; response to axon injury; cell differentiation; positive regulation of granule cell precursor proliferation; positive regulation of cardiac muscle cell proliferation; fibroblast growth factor receptor signaling pathway; positive regulation of cell fate specification; positive regulation of blood vessel endothelial cell migration; positive regulation of phosphoinositide 3-kinase activity; negative regulation of blood vessel endothelial cell migration; positive regulation of osteoblast differentiation; positive regulation of protein kinase B signaling cascade; stem cell development; positive regulation of angiogenesis; cell migration during sprouting angiogenesis; ureteric bud branching; release of sequestered calcium ion into cytosol; positive regulation of cell division; phosphatidylinositol biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; positive regulation of cell differentiation; positive regulation of epithelial cell proliferation; inositol phosphate biosynthetic process; lung development