Transforming growth factor beta-2 (TGFB2) Recombinant Protein | TGFB2 recombinant protein

Recombinant Human Transforming growth factor beta-2 (TGFB2), partial

Cat. Num. AAA7110893

• Gene Names: TGFB2; LDS4; G-TSF; TGF-beta2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transforming growth factor beta-2 (TGFB2); Recombinant Human Transforming growth factor beta-2 (TGFB2); partial; BSC-1 cell growth inhibitorCetermin; Glioblastoma-derived T-cell suppressor factor; G-TSFPolyergin; TGFB2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 304-413. Partial
• Sequence: LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC

• Organism: Homo sapiens (Human)
• Tag Information: N-terminal 6xHis-tagged
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TGFB2 recombinant protein

TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.

Product Categories/Family for TGFB2 recombinant protein

Cancer

References

NIEHS SNPs programComplete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

NCBI and Uniprot Product Information

• NCBI GI #: 208022653
• NCBI GeneID: 7042
• NCBI Accession #: NP_001129071.1
• NCBI GenBank Nucleotide #: NM_001135599.3
• UniProt Accession #: P61812; P08112; Q15579; Q15581; Q4VAV9; B4DKC5
• Molecular Weight: 16.7 kDa
• NCBI Official Full Name: transforming growth factor beta-2 isoform 1
• NCBI Official Synonym Full Names: transforming growth factor beta 2
• NCBI Official Symbol: TGFB2
• NCBI Official Synonym Symbols: LDS4; G-TSF; TGF-beta2
• NCBI Protein Information: transforming growth factor beta-2
• UniProt Protein Name: Transforming growth factor beta-2
• Protein Family: Transforming growth factor
• UniProt Gene Name: TGFB2
• UniProt Synonym Gene Names: TGF-beta-2; G-TSF; LAP

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]

Uniprot Description

TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.