Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial fission 1 protein Recombinant Protein | Fis1 recombinant protein

Mitochondrial fission 1 protein

Gene Names
Fis1; Ttc11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial fission 1 protein; Fis1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-152aa; full length protein
Sequence
MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Fis1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Fis1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,251 Da
NCBI Official Full Name
mitochondrial fission 1 protein
NCBI Official Synonym Full Names
fission, mitochondrial 1
NCBI Official Symbol
Fis1
NCBI Official Synonym Symbols
Ttc11
NCBI Protein Information
mitochondrial fission 1 protein
UniProt Protein Name
Mitochondrial fission 1 protein
UniProt Gene Name
Fis1
UniProt Synonym Gene Names
rFis1; TPR repeat protein 11
UniProt Entry Name
FIS1_RAT

Uniprot Description

FIS1: Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission. Belongs to the FIS1 family.

Protein type: Membrane protein, integral; Mitochondrial; Apoptosis

Cellular Component: integral to mitochondrial outer membrane; integral to peroxisomal membrane; membrane; mitochondrion; peroxisome; protein complex

Molecular Function: receptor binding

Biological Process: elevation of cytosolic calcium ion concentration; elevation of mitochondrial calcium ion concentration; mitochondrial fission; mitochondrial fragmentation during apoptosis; mitochondrial fusion; mitochondrion degradation; peroxisome fission; positive regulation of caspase activity; protein homooligomerization; protein targeting to mitochondrion; reduction of endoplasmic reticulum calcium ion concentration; release of cytochrome c from mitochondria

Research Articles on Fis1

Similar Products

Product Notes

The Fis1 fis1 (Catalog #AAA7042750) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-152aa; full length protein. The amino acid sequence is listed below: MEAVLNELVS VEDLKNFERK FQSEQAAGSV SKSTQFEYAW CLVRSKYNDD IRRGIVLLEE LLPKGSKEEQ RDYVFYLAVG NYRLKEYEKA LKYVRGLLQT EPQNNQAKEL ERLIDKAMKK DGLVGMAIVG GMALGVAGLA GLIGLAVSKS KS. It is sometimes possible for the material contained within the vial of "Mitochondrial fission 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.