Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor receptor superfamily member 6 Recombinant Protein | Fas recombinant protein

Tumor necrosis factor receptor superfamily member 6

Gene Names
Fas; lpr; APO1; APT1; CD95; TNFR6; Tnfrsf6; AI196731
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor superfamily member 6; Fas recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-327aa; full length protein
Sequence
QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Fas recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Fas recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,437 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 6 isoform 1
NCBI Official Synonym Full Names
Fas (TNF receptor superfamily member 6)
NCBI Official Symbol
Fas
NCBI Official Synonym Symbols
lpr; APO1; APT1; CD95; TNFR6; Tnfrsf6; AI196731
NCBI Protein Information
tumor necrosis factor receptor superfamily member 6
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 6
UniProt Gene Name
Fas
UniProt Synonym Gene Names
Apt1; Tnfrsf6
UniProt Entry Name
TNR6_MOUSE

Uniprot Description

FAS: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death- inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS- mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). Binds DAXX. Interacts with HIPK3. Part of a complex containing HIPK3 and FADD. Binds RIPK1 and FAIM2. Interacts with BRE and FEM1B. Interacts with FADD. Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Cell surface; Membrane protein, integral; Apoptosis

Cellular Component: apical plasma membrane; CD95 death-inducing signaling complex; cell soma; cell surface; cytoplasm; external side of plasma membrane; extracellular region; extracellular space; integral to plasma membrane; lipid raft; neuron projection; nucleus; perinuclear region of cytoplasm; plasma membrane; sarcolemma; secretory granule

Molecular Function: identical protein binding; kinase binding; protease binding; protein binding; protein complex binding; tumor necrosis factor receptor activity

Biological Process: activated T cell apoptosis; apoptosis; B cell mediated immunity; brain development; dendrite regeneration; gene expression; immunoglobulin production; induction of apoptosis via death domain receptors; inflammatory cell apoptosis; inflammatory response; negative regulation of apoptosis; negative regulation of B cell activation; negative thymic T cell selection; neuron apoptosis; positive regulation of apoptosis; positive regulation of caspase activity; positive regulation of MAPKKK cascade; positive regulation of protein homooligomerization; protein homooligomerization; regulation of apoptosis; regulation of caspase activity; regulation of cell proliferation; regulation of gene expression; regulation of lymphocyte differentiation; regulation of myeloid cell differentiation; renal system process; response to glucocorticoid stimulus; response to lipopolysaccharide; response to toxin; spleen development; T cell homeostasis

Research Articles on Fas

Similar Products

Product Notes

The Fas fas (Catalog #AAA7042719) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-327aa; full length protein. The amino acid sequence is listed below: QGTNSISESL KLRRRVRETD KNCSEGLYQG GPFCCQPCQP GKKKVEDCKM NGGTPTCAPC TEGKEYMDKN HYADKCRRCT LCDEEHGLEV ETNCTLTQNT KCKCKPDFYC DSPGCEHCVR CASCEHGTLE PCTATSNTNC RKQSPRNRLW LLTILVLLIP LVFIYRKYRK RKCWKRRQDD PESRTSSRET IPMNASNLSL SKYIPRIAED MTIQEAKKFA RENNIKEGKI DEIMHDSIQD TAEQKVQLLL CWYQSHGKSD AYQDLIKGLK KAECRRTLDK FQDMVQKDLG KSTPDTGNEN EGQCLE. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor superfamily member 6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.