Uncharacterized zinc metalloprotease C354.09c Recombinant Protein | SPBC354.09c recombinant protein
Recombinant Schizosaccharomyces pombe Uncharacterized zinc metalloprotease C354.09c (SPBC354.09c)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized zinc metalloprotease C354.09c; Recombinant Schizosaccharomyces pombe Uncharacterized zinc metalloprotease C354.09c (SPBC354.09c); SPBC354.09c recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-794aa; full length protein
Sequence
MTDEKHVYVPPPKDPPSYEEVALHSALNNSAPPNDGEQNETSMEEMEIIEPPSEDSSRFP LLRTKLAAIHEGWESACHSFEIRFASTFHRIPFQFLYLAVIATVIILASYYGYFDGVPAW RSVHHYGEDVLLNYIKGCDISDTRQQVMTLSSIPHLAGTVGDSSLLQMIMNRLYYEKGTI VDFREFYAYLNFPQLVSLSIDGDDSFHPSLIESYQVGGYDGVSIPTPATFGGSPSGFVNA PLVYANRGRIEDFEWLVNSGIYVESSIVLVRANQSDFALATANAEKYNASAILIFEDTYL TSLDNLNQVYPAGPYPSANSLYRGSVANHYYYVGDPLTPGWSAHEETNRISPKDANVLPS IVSIPITFNDGIELLKRLQGHGHLVKDSNWCQDLAPVLSEVWTGSKISSPGLEVNVLQDI EDKQKIINIMAQIDGYESDQILVVGAPRDSWCTGASDSSVGTSLLIDVISTFANMAQDLS WKPRRTIVFASWDARQFNAIGSTEFLEYWKESLEAKAVAYINVDVAVSGDTFTARTVPGL KKVIQRAFDVANEEDEMKAANIITDDFDYTSDLTSFLTFAGIPVVNLAFERNEENPTPMP FLGSCEDTVSWIDTFGSEYWENAARLGKIWSYLILFLANDPVVPYDLEDEINGVGEMLKR IPEIPGANALDLRKINEEFSELLESLIRFEDEIREWKSLMMHNSYTVSVKKHPELEGYNA KLARFERSFLDEAGLPGHEWYKHLIYGPNLRNSHSQLFPSIFDALLYGDVEAAQKEVKRI ALALDRAHNEIRFA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SPBC354.09c recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,966 Da
NCBI Official Full Name
Tre1 family protein, involved in vacuolar protein degradation (predicted)
NCBI Official Symbol
SPBC354.09c
NCBI Protein Information
Tre1 family protein, involved in vacuolar protein degradation (predicted)
UniProt Protein Name
Inactive zinc metalloprotease C354.09c
Protein Family
UniProt Gene Name
SPBC354.09c
UniProt Entry Name
YGV9_SCHPO
Similar Products
Product Notes
The SPBC354.09c spbc354.09c (Catalog #AAA7040305) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-794aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SPBC354.09c spbc354.09c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTDEKHVYVP PPKDPPSYEE VALHSALNNS APPNDGEQNE TSMEEMEIIE PPSEDSSRFP LLRTKLAAIH EGWESACHSF EIRFASTFHR IPFQFLYLAV IATVIILASY YGYFDGVPAW RSVHHYGEDV LLNYIKGCDI SDTRQQVMTL SSIPHLAGTV GDSSLLQMIM NRLYYEKGTI VDFREFYAYL NFPQLVSLSI DGDDSFHPSL IESYQVGGYD GVSIPTPATF GGSPSGFVNA PLVYANRGRI EDFEWLVNSG IYVESSIVLV RANQSDFALA TANAEKYNAS AILIFEDTYL TSLDNLNQVY PAGPYPSANS LYRGSVANHY YYVGDPLTPG WSAHEETNRI SPKDANVLPS IVSIPITFND GIELLKRLQG HGHLVKDSNW CQDLAPVLSE VWTGSKISSP GLEVNVLQDI EDKQKIINIM AQIDGYESDQ ILVVGAPRDS WCTGASDSSV GTSLLIDVIS TFANMAQDLS WKPRRTIVFA SWDARQFNAI GSTEFLEYWK ESLEAKAVAY INVDVAVSGD TFTARTVPGL KKVIQRAFDV ANEEDEMKAA NIITDDFDYT SDLTSFLTFA GIPVVNLAFE RNEENPTPMP FLGSCEDTVS WIDTFGSEYW ENAARLGKIW SYLILFLAND PVVPYDLEDE INGVGEMLKR IPEIPGANAL DLRKINEEFS ELLESLIRFE DEIREWKSLM MHNSYTVSVK KHPELEGYNA KLARFERSFL DEAGLPGHEW YKHLIYGPNL RNSHSQLFPS IFDALLYGDV EAAQKEVKRI ALALDRAHNE IRFA. It is sometimes possible for the material contained within the vial of "Uncharacterized zinc metalloprotease C354.09c, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
