Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vang-like protein 2 (Vangl2) Recombinant Protein | Vangl2 recombinant protein

Recombinant Mouse Vang-like protein 2 (Vangl2)

Gene Names
Vangl2; Lp; Lpp1; Ltap; stbm; Lootl; ska17; Vang1l2; loop-tail; strabismus; ska<m17Jus>; C530001F03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vang-like protein 2 (Vangl2); Recombinant Mouse Vang-like protein 2 (Vangl2); Vangl2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-521aa; full length protein
Sequence
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Vangl2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,771 Da
NCBI Official Full Name
vang-like protein 2
NCBI Official Synonym Full Names
vang-like 2 (van gogh, Drosophila)
NCBI Official Symbol
Vangl2
NCBI Official Synonym Symbols
Lp; Lpp1; Ltap; stbm; Lootl; ska17; Vang1l2; loop-tail; strabismus; ska<m17Jus>; C530001F03Rik
NCBI Protein Information
vang-like protein 2
UniProt Protein Name
Vang-like protein 2
Protein Family
UniProt Gene Name
Vangl2
UniProt Synonym Gene Names
Lpp1; Ltap
UniProt Entry Name
VANG2_MOUSE

Uniprot Description

VANGL2: Involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. Plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. Required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. Interacts through its C-terminal region with the N- terminal half of DVL1, DVL2 and DVL3. The PDZ domain of DVL1, DVL2 and DVL3 is required for the interaction. Also interacts with the PDZ domains of MAGI3, SCRIB/SCRB1 and FZD3. Belongs to the Vang family.

Protein type: Membrane protein, integral; Adaptor/scaffold; Membrane protein, multi-pass

Cellular Component: apical plasma membrane; basolateral plasma membrane; ER to Golgi transport vesicle; integral to membrane; intercellular junction; lateral plasma membrane; membrane; plasma membrane; stress fiber

Molecular Function: protein binding

Biological Process: anterior/posterior pattern formation; apical protein localization; convergent extension involved in axis elongation; convergent extension involved in neural plate elongation; convergent extension involved in organogenesis; digestive tract morphogenesis; establishment and/or maintenance of epithelial cell polarity; establishment of body hair orientation; establishment of planar polarity; glomerulus development; hair follicle development; heart looping; heparan sulfate proteoglycan biosynthetic process; inner ear receptor cell development; inner ear receptor stereocilium organization and biogenesis; multicellular organismal development; neural tube closure; patterning of blood vessels; positive regulation of JNK activity; regulation of actin cytoskeleton organization and biogenesis; regulation of Wnt receptor signaling pathway; Rho protein signal transduction; sensory cilium biogenesis; somatic stem cell division; somatic stem cell maintenance; Wnt receptor signaling pathway, planar cell polarity pathway; wound healing

Research Articles on Vangl2

Similar Products

Product Notes

The Vangl2 vangl2 (Catalog #AAA7033339) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-521aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Vangl2 vangl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTESQYSGY SYKSGHSRSS RKHRDRRDRH RSKSRDGSRG DKSVTIQAPG EPLLDNESTR GDERDDNWGE TTTVVTGTSE HSISHDDLTR IAKDMEDSVP LDCSRHLGVA AGAILALLSF LTPLAFLLLP PLLWREELEP CGTACEGLFI SVAFKLLILL LGSWALFFRR PKASLPRVFV LRALLMVLVF LLVISYWLFY GVRILDARER SYQGVVQFAV SLVDALLFVH YLAVVLLELR QLQPQFTLKV VRSTDGASRF YNVGHLSIQR VAVWILEKYY HDFPVYNPAL LNLPKSVLAK KVSGFKVYSL GEENSTNNST GQSRAVIAAA ARRRDNSHNE YYYEEAEHER RVRKRRARLV VAVEEAFTHI KRLQEEEQKN PREVMDPREA AQAIFASMAR AMQKYLRTTK QQPYHTMESI LQHLEFCITH DMTPKAFLER YLAAGPTIQY HKERWLAKQW TLVSEEPVTN GLKDGIVFLL KRQDFSLVVS TKKVPFFKLS EEFVDPKSHK FVMRLQSETS V. It is sometimes possible for the material contained within the vial of "Vang-like protein 2 (Vangl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.