Coupling protein TraD (traD) Recombinant Protein | traD recombinant protein
Recombinant Escherichia coli Coupling protein TraD (traD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coupling protein TraD (traD); Recombinant Escherichia coli Coupling protein TraD (traD); traD recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-717aa; full length protein
Sequence
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWIKISWQTFVNGCIY WWCTTLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCSEQLWSAFVLAAVVAL VICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPII RDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNP LDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRS YSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN GEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRA FFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSL PDLTCYVTLPGPYPAVKLSLKYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMA SLFEPDVPEVVSGEDVTQAEQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQ QLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for traD recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81,489 Da
NCBI Official Full Name
traD (plasmid)
NCBI Official Symbol
traD
NCBI Protein Information
traD
UniProt Protein Name
Coupling protein TraD
Protein Family
UniProt Gene Name
traD
UniProt Entry Name
TRAD1_ECOLI
Uniprot Description
Conjugative DNA transfer (CDT) is the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Couples the transferosome to a type IV secretion system. Probably forms a pore through which single-stranded plasmid DNA is transferred to the secretion system. The last 37 residues are important for determining plasmid specificity and transfer efficiency, with additional specificity conferred by the TraD-TraM pair.
Similar Products
Product Notes
The traD trad (Catalog #AAA7032140) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-717aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the traD trad for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSFNAKDMTQ GGQIASMRIR MFSQIANIML YCLFIFFWIL VGLVLWIKIS WQTFVNGCIY WWCTTLEGMR DLIKSQPVYE IQYYGKTFRM NAAQVLHDKY MIWCSEQLWS AFVLAAVVAL VICLITFFVV SWILGRQGKQ QSENEVTGGR QLTDNPKDVA RMLKKDGKDS DIRIGDLPII RDSEIQNFCL HGTVGAGKSE VIRRLANYAR QRGDMVVIYD RSGEFVKSYY DPSIDKILNP LDARCAAWDL WKECLTQPDF DNTANTLIPM GTKEDPFWQG SGRTIFAEAA YLMRNDPNRS YSKLVDTLLS IKIEKLRTYL RNSPAANLVE EKIEKTAISI RAVLTNYVKA IRYLQGIEHN GEPFTIRDWM RGVREDQKNG WLFISSNADT HASLKPVISM WLSIAIRGLL AMGENRNRRV WFFCDELPTL HKLPDLVEIL PEARKFGGCY VFGIQSYAQL EDIYGEKAAA SLFDVMNTRA FFRSPSHKIA EFAAGEIGEK EHLKASEQYS YGADPVRDGV STGKDMERQT LVSYSDIQSL PDLTCYVTLP GPYPAVKLSL KYQTRPKVAP EFIPRDINPE MENRLSAVLA AREAEGRQMA SLFEPDVPEV VSGEDVTQAE QPQQPVSPAI NDKKSDSGVN VPAGGIEQEL KMKPEEEMEQ QLPPGISESG EVVDMAAYEA WQQENHPDIQ QQMQRREEVN INVHRERGED VEPGDDF. It is sometimes possible for the material contained within the vial of "Coupling protein TraD (traD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
