Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transmembrane protein 165 (Tmem165) Recombinant Protein | Tmem165 recombinant protein

Recombinant Mouse Transmembrane protein 165 (Tmem165)

Gene Names
Tmem165; Tparl; pFT27; Tpardl; AV026557
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 165 (Tmem165); Recombinant Mouse Transmembrane protein 165 (Tmem165); Tmem165 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-323aa; Full length protein
Sequence
MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPAQQLQPQPAAV QGLEPARAEKGLTPVAPVHTNKEDAAAQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQKKWLHFISPIFVQAL TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVT IIGGIVFLAFAFSALFISPESGF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tmem165 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,791 Da
NCBI Official Full Name
transmembrane protein 165
NCBI Official Synonym Full Names
transmembrane protein 165
NCBI Official Symbol
Tmem165
NCBI Official Synonym Symbols
Tparl; pFT27; Tpardl; AV026557
NCBI Protein Information
transmembrane protein 165
UniProt Protein Name
Transmembrane protein 165
Protein Family
UniProt Gene Name
Tmem165
UniProt Synonym Gene Names
Tparl
UniProt Entry Name
TM165_MOUSE

Uniprot Description

TMEM165: Defects in TMEM165 are the cause of congenital disorder of glycosylation type 2K (CDG2K). An autosomal recessive disorder with a variable phenotype. Affected individuals show psychomotor retardation and growth retardation, and most have short stature. Other features include dysmorphism, hypotonia, eye abnormalities, acquired microcephaly, hepatomegaly, and skeletal dysplasia. Congenital disorders of glycosylation are caused by a defect in glycoprotein biosynthesis and characterized by under- glycosylated serum glycoproteins and a wide variety of clinical features. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the GDT1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: endosome; endosome membrane; Golgi apparatus; integral to membrane; intracellular membrane-bound organelle; lysosomal membrane; lysosome; membrane; trans-Golgi network membrane

Biological Process: cellular calcium ion homeostasis; Golgi calcium ion transport; protein amino acid N-linked glycosylation

Research Articles on Tmem165

Similar Products

Product Notes

The Tmem165 tmem165 (Catalog #AAA7031552) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-323aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tmem165 tmem165 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAARGSGR APTRRLLVLL LLQLLWAPAG VRAGPEEDLS HRNQEPPAPA QQLQPQPAAV QGLEPARAEK GLTPVAPVHT NKEDAAAQTN LGFIHAFVAA ISVIIVSELG DKTFFIAAIM AMRYNRLTVL AGAMLALALM TCLSVLFGYA TTVIPRVYTY YVSTALFAIF GIRMLREGLK MSPDEGQEEL EEVQAELKKK DEEFQRTKLL NGPDVETGTS TAIPQKKWLH FISPIFVQAL TLTFLAEWGD RSQLTTIVLA AREDPYGVAV GGTVGHCLCT GLAVIGGRMI AQKISVRTVT IIGGIVFLAF AFSALFISPE SGF. It is sometimes possible for the material contained within the vial of "Transmembrane protein 165 (Tmem165), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.