Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM165 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)
Rabbit anti-Human TMEM165 Polyclonal Antibody | anti-TMEM165 antibody
TMEM165 Rabbit pAb
Gene Names
TMEM165; FT27; GDT1; CDG2K; TPARL; TMPT27
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
TMEM165; Polyclonal Antibody; TMEM165 Rabbit pAb; CDG2K; FT27; GDT1; TMPT27; TPARL; anti-TMEM165 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL
Applicable Applications for anti-TMEM165 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2).
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM165 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM165 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)
Related Product Information for anti-TMEM165 antibody
Background: This gene encodes a predicted transmembrane protein with a perinuclear Golgi-like distribution in fibroblasts. Mutations in this gene are associated with the autosomal recessive disorder congenital disorder of glycosylation, type IIk. Knockdown of this gene's expression causes decreased sialylation in HEK cells and suggests this gene plays a role in terminal Golgi glycosylation. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,432 Da
NCBI Official Full Name
transmembrane protein 165
NCBI Official Synonym Full Names
transmembrane protein 165
NCBI Official Symbol
TMEM165
NCBI Official Synonym Symbols
FT27; GDT1; CDG2K; TPARL; TMPT27
NCBI Protein Information
transmembrane protein 165; TPA regulated locus; transmembrane protein PT27; transmembrane protein TPARL
UniProt Protein Name
Transmembrane protein 165
Protein Family
UniProt Gene Name
TMEM165
UniProt Synonym Gene Names
TPARL
UniProt Entry Name
TM165_HUMAN
NCBI Description
This gene encodes a predicted transmembrane protein with a perinuclear Golgi-like distribution in fibroblasts. Mutations in this gene are associated with the autosomal recessive disorder congenital disorder of glycosylation, type IIk. Knockdown of this gene's expression causes decreased sialylation in HEK cells and suggests this gene plays a role in terminal Golgi glycosylation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
Research Articles on TMEM165
Similar Products
Product Notes
The TMEM165 tmem165 (Catalog #AAA9142650) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM165 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM165 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TMEM165 tmem165 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IRMLREGLKM SPDEGQEELE EVQAELKKKD EEFQRTKLLN GPGDVETGTS ITVPQKKWL. It is sometimes possible for the material contained within the vial of "TMEM165, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
