E3 ubiquitin-protein ligase RNF128 (RNF128) Recombinant Protein | RNF128 recombinant protein
Recombinant Pongo abelii E3 ubiquitin-protein ligase RNF128 (RNF128)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF128 (RNF128); Recombinant Pongo abelii E3 ubiquitin-protein ligase RNF128 (RNF128); RNF128 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
39-428aa; full length protein
Sequence
AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPM SHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFII TAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDREIGPDGDSCA VCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSL QVPVSNEISNSASSHEEDNRSETASSGYASVQGADEPPLEEHVQSTNENLQLVNHEANSV AVDVIPHVDNPTFEEDETPHQETAVREIKS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNF128 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,483 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF128
NCBI Official Symbol
RNF128
NCBI Protein Information
E3 ubiquitin-protein ligase RNF128
UniProt Protein Name
E3 ubiquitin-protein ligase RNF128
Protein Family
UniProt Gene Name
RNF128
UniProt Entry Name
RN128_PONAB
Uniprot Description
E3 ubiquitin-protein ligase that catalyzes 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains formation. Functions as an inhibitor of cytokine gene transcription. Inhibits IL2 and IL4 transcription, thereby playing an important role in the induction of the anergic phenotype, a long-term stable state of T-lymphocyte unresponsiveness to antigenic stimulation associated with the blockade of interleukin production. Ubiquitinates ARPC5 with 'Lys-48' linkages and COR1A with 'Lys-63' linkages leading to their degradation, down-regulation of these cytosleletal components results in impaired lamellipodium formation and reduced accumulation of F-actin at the immunological synapse. Functions in the patterning of the dorsal ectoderm; sensitizes ectoderm to respond to neural-inducing signals ().
Similar Products
Product Notes
The RNF128 rnf128 (Catalog #AAA7028723) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-428aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNF128 rnf128 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AEAVWTAYLN VSWRVPHTGV NRTVWELSEE GVYGQDSPLE PVAGVLVPPD GPGALNACNP HTNFTVPTVW GSTVQVSWLA LIQRGGGCTF ADKIHLAYER GASGAVIFNF PGTRNEVIPM SHPGAGDIVA IMIGNLKGTK ILQSIQRGIQ VTMVIEVGKK HGPWVNHYSI FFVSVSFFII TAATVGYFIF YSARRLRNAR AQSRKQRQLK ADAKKAIGRL QLRTLKQGDR EIGPDGDSCA VCIELYKPND LVRILTCNHI FHKTCVDPWL LEHRTCPMCK CDILKALGIE VDVEDGSVSL QVPVSNEISN SASSHEEDNR SETASSGYAS VQGADEPPLE EHVQSTNENL QLVNHEANSV AVDVIPHVDN PTFEEDETPH QETAVREIKS. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF128 (RNF128), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
