Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RNF128 (RNF128) Recombinant Protein | RNF128 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128)

Gene Names
RNF128; GRAIL
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF128 (RNF128); Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128); RNF128 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
39-428aa; full length protein
Sequence
AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPM SHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFII TAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCA VCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSL QVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSV AVDVIPHVDNPTFEEDETPNQETAVREIKS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNF128 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,617 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF128 isoform 2
NCBI Official Synonym Full Names
ring finger protein 128, E3 ubiquitin protein ligase
NCBI Official Symbol
RNF128
NCBI Official Synonym Symbols
GRAIL
NCBI Protein Information
E3 ubiquitin-protein ligase RNF128
UniProt Protein Name
E3 ubiquitin-protein ligase RNF128
UniProt Gene Name
RNF128
UniProt Synonym Gene Names
GRAIL
UniProt Entry Name
RN128_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of this gene in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of this gene was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF128: E3 ubiquitin-protein ligase that catalyzes polyubiquitin chains. Functions as an inhibitor of cytokine gene transcription. Inhibits IL2 and IL4 transcription and this activity is likely to be mediated by E3 ligase activity. Plays an important role in the induction of the anergic phenotype. Functions in the patterning of the dorsal ectoderm; sensitizes ectoderm to respond to neural- inducing signals. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Membrane protein, integral; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: Xq22.3

Cellular Component: cytoskeleton; endoplasmic reticulum; Golgi apparatus; integral to membrane; late endosome; perinuclear region of cytoplasm

Molecular Function: ligase activity; protein binding; zinc ion binding

Biological Process: negative regulation of cytokine biosynthetic process; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of protein stability

Research Articles on RNF128

Similar Products

Product Notes

The RNF128 rnf128 (Catalog #AAA7028721) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-428aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNF128 rnf128 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AEAVWTAYLN VSWRVPHTGV NRTVWELSEE GVYGQDSPLE PVAGVLVPPD GPGALNACNP HTNFTVPTVW GSTVQVSWLA LIQRGGGCTF ADKIHLAYER GASGAVIFNF PGTRNEVIPM SHPGAVDIVA IMIGNLKGTK ILQSIQRGIQ VTMVIEVGKK HGPWVNHYSI FFVSVSFFII TAATVGYFIF YSARRLRNAR AQSRKQRQLK ADAKKAIGRL QLRTLKQGDK EIGPDGDSCA VCIELYKPND LVRILTCNHI FHKTCVDPWL LEHRTCPMCK CDILKALGIE VDVEDGSVSL QVPVSNEISN SASSHEEDNR SETASSGYAS VQGTDEPPLE EHVQSTNESL QLVNHEANSV AVDVIPHVDN PTFEEDETPN QETAVREIKS. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF128 (RNF128), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.