Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Parathyroid hormone 2 receptor (Pth2r) Recombinant Protein | Pth2r recombinant protein

Recombinant Rat Parathyroid hormone 2 receptor (Pth2r)

Gene Names
Pth2r; Pthr2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Parathyroid hormone 2 receptor (Pth2r); Recombinant Rat Parathyroid hormone 2 receptor (Pth2r); Pth2r recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-546aa; Full length protein
Sequence
QLDSDGTITIEEQIVLVMKAKMQCELNITAQFQEGEGNCFPEWDGLICWPRGTAGKTSAM PCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCFLQPDINIGKQEFFENLYI LYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRAXSIFVKDRVAQAHLG VEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIF VSFFSDTKYLWGFILIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWIYXXPILAAIG LNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFICQPHSFS GLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKTWTRWNLSIDWKKAPPCGGHR YGSVLTTVTHSTSSQSQMGPSTRLVLISSKPAKTACRQIDSHVTLPGYVWSSSEQDCQPQ STPEETKKGHGRQEDDSPVGESSRPVAFTIDTEGCKGESHPI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Pth2r recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,804 Da
NCBI Official Full Name
parathyroid hormone 2 receptor
NCBI Official Synonym Full Names
parathyroid hormone 2 receptor
NCBI Official Symbol
Pth2r
NCBI Official Synonym Symbols
Pthr2
NCBI Protein Information
parathyroid hormone 2 receptor
UniProt Protein Name
Parathyroid hormone 2 receptor
UniProt Gene Name
Pth2r
UniProt Synonym Gene Names
Pthr2; PTH2 receptor
UniProt Entry Name
PTH2R_RAT

NCBI Description

binds parathyroid hormone and induces cAMP accumulation [RGD, Feb 2006]

Uniprot Description

PTH2R: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; parathyroid hormone receptor activity

Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway

Research Articles on Pth2r

Similar Products

Product Notes

The Pth2r pth2r (Catalog #AAA7028237) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-546aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Pth2r pth2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QLDSDGTITI EEQIVLVMKA KMQCELNITA QFQEGEGNCF PEWDGLICWP RGTAGKTSAM PCPSYVYDFN HKGVAFRHCT PNGTWDFIHG SNKTWANYSD CFLQPDINIG KQEFFENLYI LYTVGYSISF GSLAVAILII GYFRRLHCTR NYIHLHLFVS FMLRAXSIFV KDRVAQAHLG VEALQSLVMQ GDLQNFIGGP SVDKSQYVGC KIAVVMFIYF LATNYYWILV EGLYLHNLIF VSFFSDTKYL WGFILIGWGF PAVFVVAWAV ARATLADTRC WELSAGDRWI YXXPILAAIG LNFILFLNTV RVLATKIWET NAVGHDMRKQ YRKLAKSTLV LVLVFGVHYI VFICQPHSFS GLWWEIRMHC ELFFNSFQGF FVSIVYCYCN GEVQAEVKKT WTRWNLSIDW KKAPPCGGHR YGSVLTTVTH STSSQSQMGP STRLVLISSK PAKTACRQID SHVTLPGYVW SSSEQDCQPQ STPEETKKGH GRQEDDSPVG ESSRPVAFTI DTEGCKGESH PI. It is sometimes possible for the material contained within the vial of "Parathyroid hormone 2 receptor (Pth2r), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.