Nitrate/nitrite sensor protein narX (narX) Recombinant Protein | narX recombinant protein
Recombinant Escherichia coli Nitrate/nitrite sensor protein narX (narX)
Gene Names
narX; ECK1216; frdR; JW1213; narR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nitrate/nitrite sensor protein narX (narX); Recombinant Escherichia coli Nitrate/nitrite sensor protein narX (narX); narX recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-598aa; full length protein
Sequence
MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for narX recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67,084 Da
NCBI Official Full Name
sensory histidine kinase in two-component regulatory system with NarL
NCBI Official Symbol
narX
NCBI Official Synonym Symbols
ECK1216; frdR; JW1213; narR
NCBI Protein Information
sensory histidine kinase in two-component regulatory system with NarL
UniProt Protein Name
Nitrate/nitrite sensor protein NarX
Protein Family
UniProt Gene Name
narX
UniProt Synonym Gene Names
narR
UniProt Entry Name
NARX_ECOLI
NCBI Description
The autophosphorylation of NarX is nitrate or nitrite dependent . [More information is available at EcoCyc: EG10646].
Uniprot Description
Acts as a sensor for nitrate/nitrite and transduces signal of nitrate availability to the NarL protein and of both nitrate/nitrite to the NarP protein. NarX probably activates NarL and NarP by phosphorylation in the presence of nitrate. NarX also plays a negative role in controlling NarL activity, probably through dephosphorylation in the absence of nitrate.
Research Articles on narX
Similar Products
Product Notes
The narX narx (Catalog #AAA7022654) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-598aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the narX narx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLKRCLSPLT LVNQVALIVL LSTAIGLAGM AVSGWLVQGV QGSAHAINKA GSLRMQSYRL LAAVPLSEKD KPLIKEMEQT AFSAELTRAA ERDGQLAQLQ GLQDYWRNEL IPALMRAQNR ETVSADVSQF VAGLDQLVSG FDRTTEMRIE TVVLVHRVMA VFMALLLVFT IIWLRARLLQ PWRQLLAMAS AVSHRDFTQR ANISGRNEMA MLGTALNNMS AELAESYAVL EQRVQEKTAG LEHKNQILSF LWQANRRLHS RAPLCERLSP VLNGLQNLTL LRDIELRVYD TDDEENHQEF TCQPDMTCDD KGCQLCPRGV LPVGDRGTTL KWRLADSHTQ YGILLATLPQ GRHLSHDQQQ LVDTLVEQLT ATLALDRHQE RQQQLIVMEE RATIARELHD SIAQSLSCMK MQVSCLQMQG DALPESSREL LSQIRNELNA SWAQLRELLT TFRLQLTEPG LRPALEASCE EYSAKFGFPV KLDYQLPPRL VPSHQAIHLL QIAREALSNA LKHSQASEVV VTVAQNDNQV KLTVQDNGCG VPENAIRSNH YGMIIMRDRA QSLRGDCRVR RRESGGTEVV VTFIPEKTFT DVQGDTHE. It is sometimes possible for the material contained within the vial of "Nitrate/nitrite sensor protein narX (narX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
