Ganglioside-induced differentiation-associated protein 1 (GDAP1) Recombinant Protein | GDAP1 recombinant protein

Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1)

Cat. Num. AAA7015489

• Gene Names: GDAP1; CMT4; CMT4A; CMTRIA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ganglioside-induced differentiation-associated protein 1 (GDAP1); Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1); GDAP1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-358aa; full length protein
• Sequence: MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for GDAP1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 108773799
• NCBI GeneID: 54332
• NCBI Accession #: NP_001035808.1
• NCBI GenBank Nucleotide #: NM_001040875.2
• UniProt Accession #: Q8TB36; A8K957; E7FJF3; E7FJF4
• Molecular Weight: 33,480 Da
• NCBI Official Full Name: ganglioside-induced differentiation-associated protein 1 isoform b
• NCBI Official Synonym Full Names: ganglioside induced differentiation associated protein 1
• NCBI Official Symbol: GDAP1
• NCBI Official Synonym Symbols: CMT4; CMT4A; CMTRIA
• NCBI Protein Information: ganglioside-induced differentiation-associated protein 1
• UniProt Protein Name: Ganglioside-induced differentiation-associated protein 1
• Protein Family: Ganglioside-induced differentiation-associated protein
• UniProt Gene Name: GDAP1
• UniProt Synonym Gene Names: GDAP1
• UniProt Entry Name: GDAP1_HUMAN

NCBI Description

This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms and a noncoding variant have been identified for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

GDAP1: the ganglioside-induced differentiation associated protein-1 gene causes autosomal recessive demyelinating or axonal Charcot-Marie-Tooth neuropathy (CMT).

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: cytoplasm; integral to mitochondrial outer membrane; membrane; mitochondrion; nucleus

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; mitochondrial fission; mitochondrial fusion; protein targeting to mitochondrion; response to retinoic acid

Disease: Charcot-marie-tooth Disease, Axonal, Type 2k; Charcot-marie-tooth Disease, Axonal, With Vocal Cord Paresis, Autosomal Recessive; Charcot-marie-tooth Disease, Recessive Intermediate A; Charcot-marie-tooth Disease, Type 4a