Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Ganglioside-induced differentiation-associated protein 1 (GDAP1) Recombinant Protein | GDAP1 recombinant protein

Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1)

Gene Names
GDAP1; CMT4; CMT4A; CMTRIA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ganglioside-induced differentiation-associated protein 1 (GDAP1); Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1); GDAP1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-358aa; full length protein
Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GDAP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,480 Da
NCBI Official Full Name
ganglioside-induced differentiation-associated protein 1 isoform b
NCBI Official Synonym Full Names
ganglioside induced differentiation associated protein 1
NCBI Official Symbol
GDAP1
NCBI Official Synonym Symbols
CMT4; CMT4A; CMTRIA
NCBI Protein Information
ganglioside-induced differentiation-associated protein 1
UniProt Protein Name
Ganglioside-induced differentiation-associated protein 1
UniProt Gene Name
GDAP1
UniProt Synonym Gene Names
GDAP1
UniProt Entry Name
GDAP1_HUMAN

NCBI Description

This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms and a noncoding variant have been identified for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

GDAP1: the ganglioside-induced differentiation associated protein-1 gene causes autosomal recessive demyelinating or axonal Charcot-Marie-Tooth neuropathy (CMT).

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: cytoplasm; integral to mitochondrial outer membrane; membrane; mitochondrion; nucleus

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; mitochondrial fission; mitochondrial fusion; protein targeting to mitochondrion; response to retinoic acid

Disease: Charcot-marie-tooth Disease, Axonal, Type 2k; Charcot-marie-tooth Disease, Axonal, With Vocal Cord Paresis, Autosomal Recessive; Charcot-marie-tooth Disease, Recessive Intermediate A; Charcot-marie-tooth Disease, Type 4a

Research Articles on GDAP1

Similar Products

Product Notes

The GDAP1 gdap1 (Catalog #AAA7015489) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-358aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GDAP1 gdap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAERQEEQRG SPPLRAEGKA DAEVKLILYH WTHSFSSQKV RLVIAEKALK CEEHDVSLPL SEHNEPWFMR LNSTGEVPVL IHGENIICEA TQIIDYLEQT FLDERTPRLM PDKESMYYPR VQHYRELLDS LPMDAYTHGC ILHPELTVDS MIPAYATTRI RSQIGNTESE LKKLAEENPD LQEAYIAKQK RLKSKLLDHD NVKYLKKILD ELEKVLDQVE TELQRRNEET PEEGQQPWLC GESFTLADVS LAVTLHRLKF LGFARRNWGN GKRPNLETYY ERVLKRKTFN KVLGHVNNIL ISAVLPTAFR VAKKRAPKVL GTTLVVGLLA GVGYFAFMLF RKRLGSMILA FRPRPNYF. It is sometimes possible for the material contained within the vial of "Ganglioside-induced differentiation-associated protein 1 (GDAP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual