Frizzled-9 (FZD9) Recombinant Protein | FZD9 recombinant protein
Recombinant Chicken Frizzled-9 (FZD9)
Gene Names
FZD9; Fz-9; cFz-9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-9 (FZD9); Recombinant Chicken Frizzled-9 (FZD9); FZD9 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-392aa; full length protein
Sequence
ACDNPEKFQYVEKSLSCAPRCSPGVDVYWSREDKDFAFVWMAVWSTLCFVSTAFTVLTFL LDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAETIACDRENGELYIIQEGLESTGCT IVFLILYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHSSYFHMAAWGIPAMKTIVIL TMRKVAGDELTGLCYVGSMDVSALTGFVLIPLSCYLVVGTSFILTGFVALFHIRKIMKTG GTNTEKLEKLMVKIGVFSILYTVPATCVIVCYFYERLNVDYWNLRALERACVPLPGRRAA DCSLEASVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQSLCNRKLGVRTRGKPCSG VSCGGVHCHYKAPTVMLHMTKTDPYLDNPTHV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Chicken
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FZD9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43,899 Da
NCBI Official Full Name
Frizzled-9
NCBI Official Synonym Full Names
frizzled class receptor 9
NCBI Official Symbol
FZD9
NCBI Official Synonym Symbols
Fz-9; cFz-9
NCBI Protein Information
frizzled-9
UniProt Protein Name
Frizzled-9
Protein Family
UniProt Gene Name
FZD9
UniProt Synonym Gene Names
FZ9; Fz-9; cFz-9
UniProt Entry Name
FZD9_CHICK
Uniprot Description
Receptor for WNT2 that is coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes.
Similar Products
Product Notes
The FZD9 fzd9 (Catalog #AAA7015427) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-392aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FZD9 fzd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ACDNPEKFQY VEKSLSCAPR CSPGVDVYWS REDKDFAFVW MAVWSTLCFV STAFTVLTFL LDPHRFQYPE RPIIFLSMCY NVYSVAFIIR SVAGAETIAC DRENGELYII QEGLESTGCT IVFLILYYFG MASSLWWVVL TLTWFLAAGK KWGHEAIEAH SSYFHMAAWG IPAMKTIVIL TMRKVAGDEL TGLCYVGSMD VSALTGFVLI PLSCYLVVGT SFILTGFVAL FHIRKIMKTG GTNTEKLEKL MVKIGVFSIL YTVPATCVIV CYFYERLNVD YWNLRALERA CVPLPGRRAA DCSLEASVPT VAVFMLKIFM SLVVGITSGV WVWSSKTLQT WQSLCNRKLG VRTRGKPCSG VSCGGVHCHY KAPTVMLHMT KTDPYLDNPT HV. It is sometimes possible for the material contained within the vial of "Frizzled-9 (FZD9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
