Frizzled-8 (fzd8) Recombinant Protein | fzd8 recombinant protein
Recombinant Xenopus laevis Frizzled-8 (fzd8)
Gene Names
fzd8-a; Xfz8; fzd8; frizzled8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-8 (fzd8); Recombinant Xenopus laevis Frizzled-8 (fzd8); fzd8 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-581aa; full length protein
Sequence
KELSCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCS MYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMD YYNRTEQTTAAPSHPEPPKPPARSVPKGRTRVEPPRSRSRATGCESGCQCRAPMVQVSNE RHPLYNRVRTGQIPNCAMPCHNPFFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDME RFKYPERPIIFLSACYLLVSTGYLIRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLV FLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLAL SSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQGGT KTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEMAQPHRPD YAVFMLKYFMCLVVGITSGVWIWSGKTLESWRAFCTRCCWGSKATGGSMYSDVSTGLTWR SGTGSSVSCPKQMPLSQV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for fzd8 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,379 Da
NCBI Official Full Name
frizzled-8
NCBI Official Synonym Full Names
frizzled class receptor 8
NCBI Official Symbol
fzd8-a
NCBI Official Synonym Symbols
Xfz8; fzd8; frizzled8
NCBI Protein Information
frizzled-8
UniProt Protein Name
Frizzled-8
Protein Family
UniProt Gene Name
fzd8
UniProt Synonym Gene Names
fz8; Fz-8; Xfz8
UniProt Entry Name
FZD8_XENLA
Uniprot Description
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt8, Wnt5A or Wnt3A induces expression of beta-catenin target genes. Displays an axis-inducing activity.
Similar Products
Product Notes
The fzd8 fzd8 (Catalog #AAA7015426) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-581aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the fzd8 fzd8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KELSCQEITV PLCKDIGYNY TYMPNQFNHD TQDEAGMEVH QFWPLVVIHC SPDLKFFLCS MYTPICLEDY KKPLPPCRSV CERARAGCAP LMRQYGFAWP DRMRCDRLPE QGNPDTLCMD YYNRTEQTTA APSHPEPPKP PARSVPKGRT RVEPPRSRSR ATGCESGCQC RAPMVQVSNE RHPLYNRVRT GQIPNCAMPC HNPFFSPEER TFTEFWIGLW SVLCFASTFA TVSTFLIDME RFKYPERPII FLSACYLLVS TGYLIRLIAG HEKVACSRGE LDLEHIIHYE TTGPALCTLV FLLIYFFGMA SSIWWVILSL TWFLAAGMKW GNEAIAGYSQ YFHLAAWLVP SIKSIAVLAL SSVDGDPVAG ICFVGNQNLD NLRGFVLAPL VIYLFIGSMF LLAGFVSLFR IRSVIKQGGT KTDKLEKLMI RIGIFSVLYT VPATIVVACF FYEQHNRQGW EVAHNCNSCQ PEMAQPHRPD YAVFMLKYFM CLVVGITSGV WIWSGKTLES WRAFCTRCCW GSKATGGSMY SDVSTGLTWR SGTGSSVSCP KQMPLSQV. It is sometimes possible for the material contained within the vial of "Frizzled-8 (fzd8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
