Western Blot (WB)
(Host: RabbitTarget Name: GBP6Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Rabbit GBP6 Polyclonal Antibody | anti-GBP6 antibody
GBP6 Antibody - N-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GBP6; Polyclonal Antibody; GBP6 Antibody - N-terminal region; anti-GBP6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN
Sequence Length
633
Applicable Applications for anti-GBP6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GBP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GBP6Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GBP6Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GBP6 antibody
This is a rabbit polyclonal antibody against GBP6. It was validated on Western Blot
Target Description: Guanylate-binding proteins, such as GBP6, are induced by interferon and hydrolyze GTP to both GDP and GMP.
Target Description: Guanylate-binding proteins, such as GBP6, are induced by interferon and hydrolyze GTP to both GDP and GMP.
Product Categories/Family for anti-GBP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
guanylate-binding protein 6 isoform 1
NCBI Official Synonym Full Names
guanylate binding protein family member 6
NCBI Official Symbol
GBP6
NCBI Protein Information
guanylate-binding protein 6
UniProt Protein Name
Guanylate-binding protein 6
Protein Family
UniProt Gene Name
GBP6
UniProt Synonym Gene Names
GBP-6
UniProt Entry Name
GBP6_HUMAN
NCBI Description
Guanylate-binding proteins, such as GBP6, are induced by interferon and hydrolyze GTP to both GDP and GMP (Olszewski et al., 2006 [PubMed 16689661]).[supplied by OMIM, Dec 2008]
Uniprot Description
GBP6: Binds GTP, GDP and GMP. Belongs to the GBP family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Hydrolase
Chromosomal Location of Human Ortholog: 1p22.2
Molecular Function: GTPase activity; GTP binding
Biological Process: metabolic process; defense response to bacterium; immune response
Research Articles on GBP6
Similar Products
Product Notes
The GBP6 gbp6 (Catalog #AAA3217819) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GBP6 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GBP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GBP6 gbp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MWCVPHPSKP NHTLVLLDTE GLGDVEKGDP KNDSWIFALA VLLCSTFVYN. It is sometimes possible for the material contained within the vial of "GBP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
