Follicle-stimulating hormone receptor (FSHR) Recombinant Protein | FSHR recombinant protein
Recombinant Donkey Follicle-stimulating hormone receptor (FSHR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Follicle-stimulating hormone receptor (FSHR); Recombinant Donkey Follicle-stimulating hormone receptor (FSHR); FSHR recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-687aa; full length protein
Sequence
CHHQVCHYSNRVFLCQESKVTEIPSDLPRNALELRFVLTKLRVIPKGAFSGFGDLKKIEI SQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDHDAFQNLPNLQYLLISNTGIKHLPA VHKIQSLQKVLLDIQDNINIHIVERNSFMGLSFESMILRLSKNGIQEIHNCAFNGTQLDE LNLSDNNNLEELPNDVFQGASGPVILDISGTRIHSLPNYGLENLKKLRARSTYNLKKLPS LEKFVALMEASLTYPSHCCAFANWRQQTSELQTTCNKSILRQEVDMTQARGERVSLAEDD ESMMYSEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYDILRVLIWFISILAITGNIIVLV ILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAA GFFTVFGSELSVYTLTAITLERWHTITHAMQLECKVQLRHAASVMLVGWIFGFGVGLLPI FGISTYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYTHIYLTVRNPNIVSSS SDTKIAKRMGILIFTDFLCMAPISFFGISASLKVALITVSKSKILLVLFYPINSCANPFL YAIFTKNFRRDFFILLSKFGCYEMQAQTYRTETSSTGHISHPKNGPCPPTPRVTNGANCT LVPLSHLAQN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Donkey
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FSHR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
76,938 Da
NCBI Official Full Name
Follicle-stimulating hormone receptor
UniProt Protein Name
Follicle-stimulating hormone receptor
Protein Family
UniProt Gene Name
FSHR
UniProt Synonym Gene Names
FSH-R
UniProt Entry Name
FSHR_EQUAS
Uniprot Description
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and SRC-ERK1/2 signaling pathways.
Similar Products
Product Notes
The FSHR fshr (Catalog #AAA7015204) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-687aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FSHR fshr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CHHQVCHYSN RVFLCQESKV TEIPSDLPRN ALELRFVLTK LRVIPKGAFS GFGDLKKIEI SQNDVLEVIE ANVFSNLPKL HEIRIEKANN LLYIDHDAFQ NLPNLQYLLI SNTGIKHLPA VHKIQSLQKV LLDIQDNINI HIVERNSFMG LSFESMILRL SKNGIQEIHN CAFNGTQLDE LNLSDNNNLE ELPNDVFQGA SGPVILDISG TRIHSLPNYG LENLKKLRAR STYNLKKLPS LEKFVALMEA SLTYPSHCCA FANWRQQTSE LQTTCNKSIL RQEVDMTQAR GERVSLAEDD ESMMYSEFDY DLCNEVVDVT CSPKPDAFNP CEDIMGYDIL RVLIWFISIL AITGNIIVLV ILITSQYKLT VPRFLMCNLA FADLCIGIYL LLIASVDIHT KSQYHNYAID WQTGAGCDAA GFFTVFGSEL SVYTLTAITL ERWHTITHAM QLECKVQLRH AASVMLVGWI FGFGVGLLPI FGISTYMKVS ICLPMDIDSP LSQLYVMSLL VLNVLAFVVI CGCYTHIYLT VRNPNIVSSS SDTKIAKRMG ILIFTDFLCM APISFFGISA SLKVALITVS KSKILLVLFY PINSCANPFL YAIFTKNFRR DFFILLSKFG CYEMQAQTYR TETSSTGHIS HPKNGPCPPT PRVTNGANCT LVPLSHLAQN. It is sometimes possible for the material contained within the vial of "Follicle-stimulating hormone receptor (FSHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
