Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteinase-activated receptor 1 (F2r) Recombinant Protein | F2r recombinant protein

Recombinant Rat Proteinase-activated receptor 1 (F2r)

Gene Names
F2r; Par1; TRGPC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteinase-activated receptor 1 (F2r); Recombinant Rat Proteinase-activated receptor 1 (F2r); F2r recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
46-432aa; Full length protein
Sequence
SFFLRNPSEDTFEQFPLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTS PWLTLFIPSVYTFVFIVSLPLNILAIAVFVFRMKVKKPAVVYMLHLAMADVLFVSVLPFK ISYYFSGTDWQFGSGMCRFATAACYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGR ANFTCVVIWVMAIMGVVPLLLKEQTTQVPGLNITTCHDVLNETLLHGFYSYYFSAFSAIF FLVPLIISTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYL LLSDSPGTETAYFAYLLCVCVTSVASCIDPLIYYYASSECQKHLYSILCCRESSDSNSCN STGQLMPSKMDTCSSHLNNSIYKKLLA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for F2r recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,281 Da
NCBI Official Full Name
Proteinase-activated receptor 1
NCBI Official Synonym Full Names
coagulation factor II (thrombin) receptor
NCBI Official Symbol
F2r
NCBI Official Synonym Symbols
Par1; TRGPC
NCBI Protein Information
proteinase-activated receptor 1
UniProt Protein Name
Proteinase-activated receptor 1
UniProt Gene Name
F2r
UniProt Synonym Gene Names
Par1; PAR-1
UniProt Entry Name
PAR1_RAT

NCBI Description

plays a role in blood coagulation, inflammatory response, and cell proliferation; mediates signal transduction via MAP kinase and other signaling pathways [RGD, Feb 2006]

Uniprot Description

PAR1: a G-protein coupled high-affinity receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelet activation and in vascular development.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Cell development/differentiation

Cellular Component: caveola; cell surface; cytosol; early endosome; integral to membrane; late endosome; neuromuscular junction; plasma membrane; postsynaptic membrane

Molecular Function: G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; receptor binding; thrombin receptor activity

Biological Process: activation of MAPKK activity; blood coagulation; caspase activation; connective tissue replacement during inflammatory response; elevation of cytosolic calcium ion concentration; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); establishment of synaptic specificity at neuromuscular junction; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); homeostasis of number of cells within a tissue; inflammatory response; negative regulation of cell proliferation; negative regulation of glomerular filtration; negative regulation of neuron apoptosis; platelet activation; positive regulation of blood coagulation; positive regulation of calcium ion transport; positive regulation of caspase activity; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of collagen biosynthetic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of JAK-STAT cascade; positive regulation of MAPKKK cascade; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of Rho protein signal transduction; positive regulation of smooth muscle contraction; positive regulation of transcription, DNA-dependent; positive regulation of vasoconstriction; protein kinase C activation; regulation of blood coagulation; regulation of interleukin-1 beta production; regulation of sensory perception of pain; release of sequestered calcium ion into cytosol; response to lipopolysaccharide; response to wounding; STAT protein nuclear translocation; tyrosine phosphorylation of STAT protein

Research Articles on F2r

Similar Products

Product Notes

The F2r f2r (Catalog #AAA7014445) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 46-432aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the F2r f2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SFFLRNPSED TFEQFPLGDE EEKNESIPLE GRAVYLNKSR FPPMPPPPFI SEDASGYLTS PWLTLFIPSV YTFVFIVSLP LNILAIAVFV FRMKVKKPAV VYMLHLAMAD VLFVSVLPFK ISYYFSGTDW QFGSGMCRFA TAACYCNMYA SIMLMTVISI DRFLAVVYPI QSLSWRTLGR ANFTCVVIWV MAIMGVVPLL LKEQTTQVPG LNITTCHDVL NETLLHGFYS YYFSAFSAIF FLVPLIISTV CYTSIIRCLS SSAVANRSKK SRALFLSAAV FCIFIVCFGP TNVLLIVHYL LLSDSPGTET AYFAYLLCVC VTSVASCIDP LIYYYASSEC QKHLYSILCC RESSDSNSCN STGQLMPSKM DTCSSHLNNS IYKKLLA. It is sometimes possible for the material contained within the vial of "Proteinase-activated receptor 1 (F2r), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.