Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Diacylglycerol O-acyltransferase 2 (DGAT2) Recombinant Protein | DGAT2 recombinant protein

Recombinant Human Diacylglycerol O-acyltransferase 2 (DGAT2)

Gene Names
DGAT2; ARAT; HMFN1045; GS1999FULL
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Diacylglycerol O-acyltransferase 2 (DGAT2); Recombinant Human Diacylglycerol O-acyltransferase 2 (DGAT2); DGAT2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-388aa; full length protein
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT MYMEALVKLFDKHKTKFGLPETEVLEVN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for DGAT2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,044 Da
NCBI Official Full Name
diacylglycerol O-acyltransferase 2 isoform 2
NCBI Official Synonym Full Names
diacylglycerol O-acyltransferase 2
NCBI Official Symbol
DGAT2
NCBI Official Synonym Symbols
ARAT; HMFN1045; GS1999FULL
NCBI Protein Information
diacylglycerol O-acyltransferase 2
UniProt Protein Name
Diacylglycerol O-acyltransferase 2
UniProt Gene Name
DGAT2
UniProt Synonym Gene Names
ARAT; Retinol O-fatty-acyltransferase
UniProt Entry Name
DGAT2_HUMAN

NCBI Description

This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

DGAT2: Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Belongs to the diacylglycerol acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.1.76; Membrane protein, multi-pass; Transferase; EC 2.3.1.20; Lipid Metabolism - glycerolipid; Membrane protein, integral; Cofactor and Vitamin Metabolism - retinol

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to membrane; lipid particle; mitochondrion; perinuclear region of cytoplasm

Molecular Function: 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity

Biological Process: cholesterol homeostasis; diacylglycerol metabolic process; fatty acid homeostasis; glycerol metabolic process; negative regulation of fatty acid oxidation; positive regulation of gluconeogenesis; regulation of lipoprotein metabolic process; retinol metabolic process; sequestering of lipid; triacylglycerol biosynthetic process

Research Articles on DGAT2

Similar Products

Product Notes

The DGAT2 dgat2 (Catalog #AAA7013739) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-388aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the DGAT2 dgat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKTLIAAYSG VLRGERQAEA DRSQRSHGGP ALSREGSGRW GTGSSILSAL QDLFSVTWLN RSKVEKQLQV ISVLQWVLSF LVLGVACSAI LMYIFCTDCW LIAVLYFTWL VFDWNTPKKG GRRSQWVRNW AVWRYFRDYF PIQLVKTHNL LTTRNYIFGY HPHGIMGLGA FCNFSTEATE VSKKFPGIRP YLATLAGNFR MPVLREYLMS GGICPVSRDT IDYLLSKNGS GNAIIIVVGG AAESLSSMPG KNAVTLRNRK GFVKLALRHG ADLVPIYSFG ENEVYKQVIF EEGSWGRWVQ KKFQKYIGFA PCIFHGRGLF SSDTWGLVPY SKPITTVVGE PITIPKLEHP TQQDIDLYHT MYMEALVKLF DKHKTKFGLP ETEVLEVN. It is sometimes possible for the material contained within the vial of "Diacylglycerol O-acyltransferase 2 (DGAT2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.