Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bcl-2-like protein 1 (Bcl2l1) Recombinant Protein | Bcl2l1 recombinant protein

Recombinant Rat Bcl-2-like protein 1 (Bcl2l1)

Gene Names
Bcl2l1; Bclx; Bcl2l; bcl-X; Bcl-xl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bcl-2-like protein 1 (Bcl2l1); Recombinant Rat Bcl-2-like protein 1 (Bcl2l1); Bcl2l1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-233aa; Full length protein
Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Bcl2l1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,865 Da
NCBI Official Full Name
bcl-2-like protein 1 isoform 2
NCBI Official Synonym Full Names
Bcl2-like 1
NCBI Official Symbol
Bcl2l1
NCBI Official Synonym Symbols
Bclx; Bcl2l; bcl-X; Bcl-xl
NCBI Protein Information
bcl-2-like protein 1
UniProt Protein Name
Bcl-2-like protein 1
Protein Family
UniProt Gene Name
Bcl2l1
UniProt Synonym Gene Names
Bclx; Blc2l; Bcl2-L-1
UniProt Entry Name
B2CL1_RAT

NCBI Description

inhibits neuronal apoptosis; may provide neuroprotection against ischemic brian injury [RGD, Feb 2006]

Uniprot Description

Bcl-xL: an antiapoptotic member of the Bcl-2 family. Located at the outer mitochondrial membrane and regulates outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are potent inducers of cell apoptosis. Two alternatively spliced isoforms have been reported.

Protein type: Mitochondrial; Membrane protein, integral; Autophagy; Apoptosis

Cellular Component: cell junction; centrosome; cytoplasm; cytosol; integral to membrane; intracellular; mitochondrial envelope; mitochondrial inner membrane; mitochondrial matrix; mitochondrial membrane; mitochondrial outer membrane; mitochondrion; nuclear membrane; synaptic vesicle membrane

Molecular Function: BH domain binding; BH3 domain binding; caspase inhibitor activity; identical protein binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein kinase binding

Biological Process: aging; apoptosis; cell proliferation; cellular process regulating host cell cycle in response to virus; cerebral cortex development; DNA damage response, signal transduction resulting in induction of apoptosis; endocytosis; fertilization; germ cell development; growth; in utero embryonic development; male gonad development; mitotic cell cycle checkpoint; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of neuron apoptosis; neuron apoptosis; ovarian follicle development; positive regulation of apoptosis; positive regulation of cell proliferation; regulation of apoptosis; regulation of mitochondrial membrane permeability; regulation of mitochondrial membrane potential; release of cytochrome c from mitochondria; response to cycloheximide; response to cytokine stimulus; response to electrical stimulus; response to hydrogen peroxide; response to hypoxia; response to inorganic substance; response to lead ion; response to organic cyclic substance; response to organic nitrogen; response to oxidative stress; response to peptide hormone stimulus; response to radiation; response to virus; spermatogenesis; suppression by virus of host apoptosis

Research Articles on Bcl2l1

Similar Products

Product Notes

The Bcl2l1 bcl2l1 (Catalog #AAA7010327) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-233aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Bcl2l1 bcl2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEPERETPSA INGNPSWHLA DSPAVNGATG HSSSLDAREV IPMAAVKQAL REAGDEFELR YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL CVESVDKEMQ VLVSRIASWM ATYLNDHLEP WIQENGGWDT FVDLYGNNAA AESRKGQERF NRWFLTGMTV AGVVLLGSLF SRK. It is sometimes possible for the material contained within the vial of "Bcl-2-like protein 1 (Bcl2l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.