Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apoptosis regulator BAX (Bax) Recombinant Protein | Bax recombinant protein

Recombinant Rat Apoptosis regulator BAX (Bax)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis regulator BAX (Bax); Recombinant Rat Apoptosis regulator BAX (Bax); Bax recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-192aa; full length protein
Sequence
MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLS ECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Bax recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
Apoptosis regulator BAX
NCBI Official Synonym Full Names
Bcl2-associated X protein
NCBI Official Symbol
Bax
NCBI Protein Information
apoptosis regulator BAX
UniProt Protein Name
Apoptosis regulator BAX
Protein Family
UniProt Gene Name
Bax
UniProt Entry Name
BAX_RAT

NCBI Description

Bcl2-related gene; involved in the regulation of apoptotic cell death [RGD, Feb 2006]

Uniprot Description

BAX: Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. Homodimer. Forms higher oligomers under stress conditions. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37. Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro- myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T- cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. Belongs to the Bcl-2 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Membrane protein, integral; Apoptosis; Mitochondrial

Cellular Component: cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; intracellular; membrane; mitochondrial membrane; mitochondrial outer membrane; mitochondrial permeability transition pore complex; mitochondrion; nuclear envelope; nucleus; perinuclear region of cytoplasm; pore complex

Molecular Function: BH domain binding; BH3 domain binding; channel activity; chaperone binding; heat shock protein binding; identical protein binding; lipid binding; protein binding; protein complex binding; protein heterodimerization activity; protein homodimerization activity

Biological Process: aging; apoptosis; apoptotic mitochondrial changes; B cell apoptosis; B cell homeostasis; B cell homeostatic proliferation; B cell negative selection; blood vessel remodeling; brain development; caspase activation; caspase activation via cytochrome c; cell proliferation; cellular respiration; cerebral cortex development; development of secondary sexual characteristics; DNA damage response, signal transduction resulting in induction of apoptosis; establishment and/or maintenance of transmembrane electrochemical gradient; fertilization; germ cell development; germ cell programmed cell death; glycosphingolipid metabolic process; homeostasis of number of cells; homeostasis of number of cells within a tissue; hypothalamus development; induction of apoptosis via death domain receptors; inner mitochondrial membrane organization and biogenesis; kidney development; leukocyte homeostasis; limb morphogenesis; male gonad development; mitochondrial fragmentation during apoptosis; mitochondrial fusion; myeloid cell homeostasis; negative regulation of cell proliferation; negative regulation of fibroblast proliferation; negative regulation of neuron apoptosis; negative regulation of peptidyl-serine phosphorylation; negative regulation of protein binding; nervous system development; neuron apoptosis; neuron migration; odontogenesis of dentine-containing teeth; outer mitochondrial membrane organization and biogenesis; ovarian follicle development; positive regulation of apoptosis; positive regulation of apoptosis involved in mammary gland involution; positive regulation of B cell apoptosis; positive regulation of neuron apoptosis; positive regulation of pigmentation; positive regulation of protein oligomerization; positive regulation of release of sequestered calcium ion into cytosol; post-embryonic camera-type eye morphogenesis; post-embryonic development; protein homooligomerization; protein insertion into mitochondrial membrane during induction of apoptosis; protein oligomerization; reduction of endoplasmic reticulum calcium ion concentration; regulation of caspase activity; regulation of cell cycle; regulation of mammary gland epithelial cell proliferation; regulation of mitochondrial membrane potential; regulation of neuron apoptosis; regulation of nitrogen utilization; regulation of protein heterodimerization activity; regulation of protein homodimerization activity; release of cytochrome c from mitochondria; release of matrix enzymes from mitochondria; response to axon injury; response to cocaine; response to copper ion; response to corticosterone stimulus; response to DNA damage stimulus; response to drug; response to gamma radiation; response to ionizing radiation; response to salt stress; response to toxin; response to wounding; retina development in camera-type eye; retinal cell programmed cell death; Sertoli cell proliferation; sex differentiation; spermatid differentiation; spermatogenesis; T cell homeostatic proliferation; transformed cell apoptosis; vagina development

Research Articles on Bax

Similar Products

Product Notes

The Bax bax (Catalog #AAA7010304) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-192aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Bax bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDGSGEQLGG GGPTSSEQIM KTGAFLLQGF IQDRAGRMAG ETPELTLEQP PQDASTKKLS ECLRRIGDEL DSNMELQRMI ADVDTDSPRE VFFRVAADMF ADGNFNWGRV VALFYFASKL VLKALCTKVP ELIRTIMGWT LDFLRERLLV WIQDQGGWDG LLSYFGTPTW QTVTIFVAGV LTASLTIWKK MG. It is sometimes possible for the material contained within the vial of "Apoptosis regulator BAX (Bax), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.