Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) Recombinant Protein | ALOX5AP recombinant protein

Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Gene Names
ALOX5AP; FLAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arachidonate 5-lipoxygenase-activating protein (ALOX5AP); Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP); ALOX5AP recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-161aa; Full Length
Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Sequence Length
161
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ALOX5AP recombinant protein
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Product Categories/Family for ALOX5AP recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
241
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.2 kDa
NCBI Official Full Name
arachidonate 5-lipoxygenase-activating protein isoform 2
NCBI Official Synonym Full Names
arachidonate 5-lipoxygenase activating protein
NCBI Official Symbol
ALOX5AP
NCBI Official Synonym Symbols
FLAP
NCBI Protein Information
arachidonate 5-lipoxygenase-activating protein
UniProt Protein Name
Arachidonate 5-lipoxygenase-activating protein
UniProt Gene Name
ALOX5AP
UniProt Synonym Gene Names
FLAP
UniProt Entry Name
AL5AP_HUMAN

NCBI Description

This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

ALOX5AP: Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. Genetic variations in ALOX5AP may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Genetic variations in ALOX5AP may be associated with susceptibility to myocardial infarction. Involvement in myocardial infarction is however unclear: according to some authors (PubMed:14770184), a 4-SNP haplotype in ALOX5AP confers risk of myocardial infarction, while according to other (PubMed:17304054) ALOX5AP is not implicated in this condition. Belongs to the MAPEG family.

Protein type: Endoplasmic reticulum; Activator; Nuclear envelope; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; membrane; nuclear envelope; nuclear membrane

Molecular Function: arachidonic acid binding; enzyme activator activity; glutathione peroxidase activity; glutathione transferase activity; leukotriene-C4 synthase activity; protein binding; protein N-terminus binding

Biological Process: leukotriene biosynthetic process; leukotriene metabolic process; lipoxygenase pathway; positive regulation of catalytic activity

Disease: Stroke, Ischemic

Research Articles on ALOX5AP

Similar Products

Product Notes

The ALOX5AP alox5ap (Catalog #AAA7007732) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-161aa; Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ALOX5AP alox5ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDQETVGNVV LLAIVTLISV VQNGFFAHKV EHESRTQNGR SFQRTGTLAF ERVYTANQNC VDAYPTFLAV LWSAGLLCSQ VPAAFAGLMY LFVRQKYFVG YLGERTQSTP GYIFGKRIIL FLFLMSVAGI FNYYLIFFFG SDFENYIKTI STTISPLLLI P. It is sometimes possible for the material contained within the vial of "Arachidonate 5-lipoxygenase-activating protein (ALOX5AP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.