Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase MARCH11 (MARCH11) Recombinant Protein | MARCH11 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase MARCH11 (MARCH11)

Gene Names
MARCH11; MARCH-XI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase MARCH11 (MARCH11); Recombinant Human E3 ubiquitin-protein ligase MARCH11 (MARCH11); MARCH11 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-402. Full Length
Sequence
MSFEGGHGGSRCRGAESGDAEPPPQPPPPPPPTPPPGEPAPVPAAPRYLPPLPASPETPERAAGPSEPLGEVAPRCRGADELPPPPLPLQPAGQEVAAAGDSGEGPRRLPEAAAAKGGPGESEAGAGGERERRGAGDQPETRSVCSSRSSSSGGGDQRAGHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVIAIKMKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRPHEDLSEDNSSGEVVMRVTSV
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MARCH11 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,226 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH11
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 11
NCBI Official Symbol
MARCH11
NCBI Official Synonym Symbols
MARCH-XI
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH11
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH11
UniProt Gene Name
MARCH11
UniProt Synonym Gene Names
MARCH-XI
UniProt Entry Name
MARHB_HUMAN

NCBI Description

MARCH11 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their intracellular transport. March11 appears to have a role in ubiquitin-mediated protein sorting in the trans-Golgi network (TGN)-multivesicular body (MVB) transport pathway (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010]

Uniprot Description

MARCH11: E3 ubiquitin-protein ligase that mediates polyubiquitination of CD4. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May play a role in ubuquitin-dependent protein sorting in developmenting spermatids. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; EC 6.3.2.19; Vesicle; Ligase; Membrane protein, integral; EC 6.3.2.-; Membrane protein, multi-pass; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5p15.1

Cellular Component: cytoplasmic vesicle membrane; integral to membrane

Molecular Function: ligase activity; zinc ion binding

Biological Process: protein ubiquitination

Research Articles on MARCH11

Similar Products

Product Notes

The MARCH11 march11 (Catalog #AAA7006891) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-402. Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MARCH11 march11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSFEGGHGGS RCRGAESGDA EPPPQPPPPP PPTPPPGEPA PVPAAPRYLP PLPASPETPE RAAGPSEPLG EVAPRCRGAD ELPPPPLPLQ PAGQEVAAAG DSGEGPRRLP EAAAAKGGPG ESEAGAGGER ERRGAGDQPE TRSVCSSRSS SSGGGDQRAG HQHQHHQPIC KICFQGAEQG ELLNPCRCDG SVRYTHQLCL LKWISERGSW TCELCCYRYH VIAIKMKQPC QWQSISITLV EKVQMIAVIL GSLFLIASVT WLLWSAFSPY AVWQRKDILF QICYGMYGFM DLVCIGLIVH EGAAVYRVFK RWRAVNLHWD VLNYDKATDI EESSRGESST SRTLWLPLTA LRNRNLVHPT QLTSPRFQCG YVLLHLFNRM RPHEDLSEDN SSGEVVMRVT SV . It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase MARCH11 (MARCH11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.