Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human MAG Monoclonal Antibody | anti-MAG antibody

MAG (Myelin Associated Glycoprotein, GMA, Myelin-associated Glycoprotein Precursor, SIGLEC4A, Siglec-4a, SIGLEC-4A, S-MAG) (AP)

Gene Names
MAG; GMA; S-MAG; SPG75; SIGLEC4A; SIGLEC-4A
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAG; Monoclonal Antibody; MAG (Myelin Associated Glycoprotein; GMA; Myelin-associated Glycoprotein Precursor; SIGLEC4A; Siglec-4a; SIGLEC-4A; S-MAG) (AP); anti-MAG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C7
Specificity
Recognizes human MAG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
626
Applicable Applications for anti-MAG antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa119-208 from human MAG (NP_002352) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(MAG monoclonal antibody. Western Blot analysis of MAG expression in Jurkat.)

Western Blot (WB) (MAG monoclonal antibody. Western Blot analysis of MAG expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAG on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAG on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAG is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAG is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MAG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myelin-associated glycoprotein isoform a
NCBI Official Synonym Full Names
myelin associated glycoprotein
NCBI Official Symbol
MAG
NCBI Official Synonym Symbols
GMA; S-MAG; SPG75; SIGLEC4A; SIGLEC-4A
NCBI Protein Information
myelin-associated glycoprotein
UniProt Protein Name
Myelin-associated glycoprotein
Protein Family
UniProt Gene Name
MAG
UniProt Synonym Gene Names
GMA
UniProt Entry Name
MAG_HUMAN

NCBI Description

The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

MAG: Adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3- linked sialic acid. Binds to RTN4R. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: paranode region of axon; integral to membrane; plasma membrane

Molecular Function: carbohydrate binding

Biological Process: substantia nigra development; nerve growth factor receptor signaling pathway; negative regulation of axonogenesis; regulation of axonogenesis; blood coagulation; cell adhesion; leukocyte migration

Research Articles on MAG

Similar Products

Product Notes

The MAG mag (Catalog #AAA6132176) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAG (Myelin Associated Glycoprotein, GMA, Myelin-associated Glycoprotein Precursor, SIGLEC4A, Siglec-4a, SIGLEC-4A, S-MAG) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAG mag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.