TIE-1/Fc Chimera, soluble Recombinant Protein | TIE-1/Fc Chimera recombinant protein

Human TIE-1/Fc Chimera, soluble

Cat. Num. AAA691866

• Gene Names: TIE1; TIE; JTK14
• Reactivity: Human
• Purity: > 90% by SDS-PAGE & silver stain
• Synonyms: TIE-1/Fc Chimera; soluble; Human TIE-1/Fc Chimera; Recombinant Human soluble TIE-1/Fc Chimera; Tyrosine-protein kinase Tie-1; TIE-1/Fc Chimera recombinant protein

• Host: Insect Cells
• Reactivity: Human
• Purity/Purification: > 90% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: VDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRT PPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNS PGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHE AQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGP GCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQC PGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQ NGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINC AAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSG FWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFS GDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLS RPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVP GPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQL YHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPG PISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASI QGLGDWSNTVEESTLGNGLQAEGPVQETRSDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
• Sequence Length: 957

• N Terminal Sequence: VDLTLLA
• Buffer: PBS
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sTIE-1/Fc should be stored in working aliquots at -20 degree C.

Testing Data

Related Product Information for TIE-1/Fc Chimera recombinant protein

Recombinant human soluble TIE-1 was fused with the Fc part of human IgG1. The soluble receptor protein consists of the full extracellular domain (Met1-Glu749). The recombinant mature TIE-1/Fc is a disulfide-linked homodimeric protein. Human TIE-1/Fc monomer has a calculated molecular mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 125 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-1 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.

Product Categories/Family for TIE-1/Fc Chimera recombinant protein

Soluble receptors

References

1. Partanen J and DJ Dumont (1999) Curr Top Microbiol Immunol 237:159. 2. Takakura N et al, (1998) Immunity 9:677. 3. Procopio W et al, (1999) J Biol Chem 274:30196. 4. Sato et al. (1993) PNAS 90:9355 5.Gale et al., (1999) Gen Dev 13:1055

NCBI and Uniprot Product Information

• NCBI GI #: 4885631
• NCBI GeneID: 7075
• NCBI Accession #: NP_005415
• NCBI GenBank Nucleotide #: NM_005424
• UniProt Accession #: P35590; B5A949; B5A950
• Molecular Weight: 240 kDa Dimer
• NCBI Official Full Name: tyrosine-protein kinase receptor Tie-1 isoform 1
• NCBI Official Synonym Full Names: tyrosine kinase with immunoglobulin-like and EGF-like domains 1
• NCBI Official Symbol: TIE1
• NCBI Official Synonym Symbols: TIE; JTK14
• NCBI Protein Information: tyrosine-protein kinase receptor Tie-1; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1
• UniProt Protein Name: Tyrosine-protein kinase receptor Tie-1
• UniProt Gene Name: TIE1
• UniProt Synonym Gene Names: TIE
• UniProt Entry Name: TIE1_HUMAN

NCBI Description

This gene encodes a member of the tyrosine protein kinase family. The encoded protein plays a critical role in angiogenesis and blood vessel stability by inhibiting angiopoietin 1 signaling through the endothelial receptor tyrosine kinase Tie2. Ectodomain cleavage of the encoded protein relieves inhibition of Tie2 and is mediated by multiple factors including vascular endothelial growth factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

Function: Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis. Ref.8

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Subunit structure: Heterodimer with TEK/TIE2.

Subcellular location: Cell membrane; Single-pass type I membrane protein Ref.7 Ref.8.

Tissue specificity: Specifically expressed in developing vascular endothelial cells.

Post-translational modification: Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2. Ref.7

Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.Contains 3 EGF-like domains.Contains 3 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.