Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

hCD244 recombinant protein

Recombinant hCD244 (2B4)-muCD8 Purified (with Antibiotics)

Applications
Flow Cytometry, Functional Assay, ELISA
Synonyms
hCD244; Recombinant hCD244 (2B4)-muCD8 Purified (with Antibiotics); CD244 (2B4)-muIg Purified (with Antibiotics); 2B4; SLAMF4; hCD244 recombinant protein
Ordering
For Research Use Only!
Applicable Applications for hCD244 recombinant protein
Flow Cytometry (FC/FACS), ELISA (EIA)
Transfectant Cell Line
CHO
Molecular Structure
A soluble molecule consisting of murine CD8 alpha signal peptide residual amino acids and linker: (1)kpqapegkgc(10)
The mature extracellular domain of human CD244 (199aa):
(11)qgsadhvvsisgvplqlqpnsiqtkvdsiawkkllpsqngfhhilkwengslpsntsndrfsfivknlsllikaaqqqdsglyclevtsisgkvqtatfqvfvfdkvekprlqgqgkildrgrcqvalsclvsrdgnvsyawyrgskliqtagnltyldeevdingthtytcnvsnpvsweshtlnltqdcqnahqefr(209) murine IgG2a Fc + hinge regions: (233aa) eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk (442aa total).
The molecule has a predicted monomeric non glycosylated molecular weight of 49.5 kd.. The molecule is dimeric. In SDS-PAGE, it runs at apporoximately 135 kD native, and 70 kD reduced.. CD244-muIg binds to recombinant CD48 in EIA and cell surface CD48 on Raji cell surface in FACS. This binding is blocked by anti-CD48 mAb (Cat# MBS666325).
Related Product Information for hCD244 recombinant protein
CD244 (2B4, SLAMF4) is a 66 kD member of the CD2/SLAM related receptor family (SRR). It is expressed on NK (3), Tcell subsets, monocytes and eosinophils(4). It is expressed at high levels on Leuikemia initiating cells, and plays a role in their proliferative potential (5). In mice there are two transcription varients, a long form and a short form of CD244 each of which have distinct signaling properties. In humans, only th long form is expressed.
Decreased CD244 expression on monocytes of SLE patients correlated (negatively) with autoantibody titers(2). CD244 mediated function in immune response can vary greatly dependant on the context of its ligation.
Product Categories/Family for hCD244 recombinant protein
References
1) Boles KS, Mathew PA, et al. (1999) Tissue Antigens 54(1): 27-34. 2) Mak A, AM Fairhurst, et al. (2017) Clinical Rheumatology 37(3): 811-816. doi.org/10.1007/s10067-017-3698-2. 3) Vacca P, MC Mingarri, et al. (2006) Blood 108: 4078-4085. 4) Munitz A, Levi-Schaffer F, et al. (2005) J Immunol 174(1): 110-118. 5) Zhang F, Zheng J, et al. (2017) Haematologica Doi: 10.3324/haematol.2016.151555.

Similar Products

Product Notes

The hCD244 (Catalog #AAA666939) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's hCD244 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), ELISA (EIA). Researchers should empirically determine the suitability of the hCD244 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "hCD244, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.