Interleukin 22, Rat Active Protein | IL22 active protein
Interleukin 22, Recombinant, Rat (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF)
Gene Names
IL22; TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; MGC79382; MGC79384; TIFIL-23
Purity
Highly Purified> 97% as determined by SDS-PAGE and visualized by silver stain. Endotoxin: <1EU/ug (LAL)
Synonyms
Interleukin 22; Rat; Recombinant; Rat (IL-22; IL-10 Related T cell-derived Inducible Factor; IL-TIF); IL22 active protein
Purity/Purification
Highly Purified
> 97% as determined by SDS-PAGE and visualized by silver stain. Endotoxin: <1EU/ug (LAL)
> 97% as determined by SDS-PAGE and visualized by silver stain. Endotoxin: <1EU/ug (LAL)
Form/Format
Supplied as a lyophilized powder from PBS, BSA.
Sequence
MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV
Activity
Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml.
Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA per
1ug of cytokine.
Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA per
1ug of cytokine.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for IL22 active protein
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways.
Product Categories/Family for IL22 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD.
NCBI Official Full Name
interleukin-22
NCBI Official Synonym Full Names
interleukin 22
NCBI Official Symbol
IL22
NCBI Official Synonym Symbols
TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; MGC79382; MGC79384; TIFIL-23
NCBI Protein Information
interleukin-22; cytokine Zcyto18; OTTHUMP00000240117; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor
UniProt Protein Name
Interleukin 22
Protein Family
UniProt Gene Name
IL22
UniProt Entry Name
Q6NWP4_HUMAN
Uniprot Description
IL22: Cytokine that contributes to the inflammatory response in vivo. Belongs to the IL-10 family.
Protein type: Cytokine; Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 12q15
Cellular Component: extracellular space; extracellular region
Molecular Function: interleukin-22 receptor binding; cytokine activity
Biological Process: cell-cell signaling; response to glucocorticoid stimulus; acute-phase response; inflammatory response
Research Articles on IL22
Similar Products
Product Notes
The IL22 il22 (Catalog #AAA650800) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLPINSQCKL EAANFQQPYI VNRTFMLAKE ASLADNNTDV RLIGEELFRG VKAKDQCYLM KQVLNFTLED VLLPQSDRFQ PYMQEVVPFL TKLSIHLSPC HISGDDQNIQ KNVRQLKETV QKLGESGEIK AIGELDLLFM SLR NACV. It is sometimes possible for the material contained within the vial of "Interleukin 22, Rat, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
