Mouse anti-Human IFNE1 Monoclonal Antibody | anti-IFNE antibody

IFNE1 (Interferon epsilon, IFN-epsilon, Interferon epsilon-1, IFNE1, UNQ360/PRO655, MGC119018, MGC119020, PRO655)

Cat. Num. AAA649046

• Gene Names: IFNE; IFN-E; IFNE1; IFNT1; INFE1; PRO655
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunoprecipitation
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: IFNE1; Monoclonal Antibody; IFNE1 (Interferon epsilon; IFN-epsilon; Interferon epsilon-1; UNQ360/PRO655; MGC119018; MGC119020; PRO655); Anti -IFNE1 (Interferon epsilon; anti-IFNE antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B8
• Specificity: Recognizes human IFNE1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR*

• Applicable Applications for anti-IFNE antibody: ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunoprecipitation.; Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.
• Immunogen: Partial recombinant protein corresponding to aa109-209 from human IFNE1 (NP_795372) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(IFNE1 monoclonal antibody Western Blot analysis of IFNE expression in human spleen.)

Immunoprecipitation (IP)

(Immunoprecipitation of IFNE transfected lysate using IFNE monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IFNE rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged IFNE1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-IFNE antibody

Antibodies; Abs to Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 28882045
• NCBI GeneID: 338376
• NCBI Accession #: NP_795372.1
• NCBI GenBank Nucleotide #: NM_176891.4
• UniProt Accession #: Q86WN2
• Molecular Weight: 24,414 Da
• NCBI Official Full Name: interferon epsilon
• NCBI Official Synonym Full Names: interferon, epsilon
• NCBI Official Symbol: IFNE
• NCBI Official Synonym Symbols: IFN-E; IFNE1; IFNT1; INFE1; PRO655
• NCBI Protein Information: interferon epsilon; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1
• UniProt Protein Name: Interferon epsilon
• Protein Family: Interferon
• UniProt Gene Name: IFNE
• UniProt Synonym Gene Names: IFNE1; IFN-epsilon
• UniProt Entry Name: IFNE_HUMAN

Uniprot Description

Function: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections

By similarity.

Subcellular location: Secreted

Probable.

Tissue specificity: Endometrium-specific. Ref.4

Developmental stage: Highly expressed in endometrial epithelial cells in proliferative phase of the menstrual cycle. Levels decrease approximately 10-fold in the secretory phase. Virtually undetectable in samples from postmenopausal women. Ref.4

Induction: By estrogens

Probable. Ref.4

Sequence similarities: Belongs to the alpha/beta interferon family.