Western Blot (WB)
(Western Blot analysis of IFNE1 expression in transfected 293T cell line by IFNE1 polyclonal antibody. Lane 1: IFNE1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human IFNE1 Polyclonal Antibody | anti-IFNE antibody
IFNE1 (Interferon epsilon, IFN-epsilon, Interferon epsilon-1, IFNE1, UNQ360/PRO655, MGC119018, MGC119020, PRO655)
Gene Names
IFNE; IFN-E; IFNE1; IFNT1; INFE1; PRO655
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
IFNE1; Polyclonal Antibody; IFNE1 (Interferon epsilon; IFN-epsilon; Interferon epsilon-1; UNQ360/PRO655; MGC119018; MGC119020; PRO655); Anti -IFNE1 (Interferon epsilon; anti-IFNE antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFNE.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Applicable Applications for anti-IFNE antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human IFNE, aa1-208 (NP_795372.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of IFNE1 expression in transfected 293T cell line by IFNE1 polyclonal antibody. Lane 1: IFNE1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of IFNE1 expression in transfected 293T cell line by IFNE1 polyclonal antibody. Lane 1: IFNE1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-IFNE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,414 Da
NCBI Official Full Name
interferon epsilon
NCBI Official Synonym Full Names
interferon, epsilon
NCBI Official Symbol
IFNE
NCBI Official Synonym Symbols
IFN-E; IFNE1; IFNT1; INFE1; PRO655
NCBI Protein Information
interferon epsilon; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1
UniProt Protein Name
Interferon epsilon
Protein Family
UniProt Gene Name
IFNE
UniProt Synonym Gene Names
IFNE1; IFN-epsilon
UniProt Entry Name
IFNE_HUMAN
Uniprot Description
IFNE1: Belongs to the alpha/beta interferon family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 9p21.3
Cellular Component: extracellular space
Molecular Function: interferon-alpha/beta receptor binding; cytokine activity
Biological Process: B cell proliferation; adaptive immune response; response to exogenous dsRNA; cytokine and chemokine mediated signaling pathway; B cell differentiation; defense response to bacterium; natural killer cell activation during immune response; regulation of MHC class I biosynthetic process; innate immune response; defense response to virus; humoral immune response; positive regulation of peptidyl-serine phosphorylation of STAT protein; T cell activation during immune response
Research Articles on IFNE
Similar Products
Product Notes
The IFNE ifne (Catalog #AAA6006279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNE1 (Interferon epsilon, IFN-epsilon, Interferon epsilon-1, IFNE1, UNQ360/PRO655, MGC119018, MGC119020, PRO655) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the IFNE ifne for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIIKHFFGTV LVLLASTTIF SLDLKLIIFQ QRQVNQESLK LLNKLQTLSI QQCLPHRKNF LLPQKSLSPQ QYQKGHTLAI LHEMLQQIFS LFRANISLDG WEENHTEKFL IQLHQQLEYL EALMGLEAEK LSGTLGSDNL RLQVKMYFRR IHDYLENQDY STCAWAIVQV EISRCLFFVF SLTEKLSKQG RPLNDMKQEL TTEFRSPR. It is sometimes possible for the material contained within the vial of "IFNE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
