Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ARL3 expression in transfected 293T cell line by ARL3 polyclonal antibody. Lane 1: ARL3 transfected lysate (20.02kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ARL3 Polyclonal Antibody | anti-ARL3 antibody

ARL3 (ADP-ribosylation Factor-like Protein 3, ARFL3)

Gene Names
ARL3; ARFL3
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ARL3; Polyclonal Antibody; ARL3 (ADP-ribosylation Factor-like Protein 3; ARFL3); Anti -ARL3 (ADP-ribosylation Factor-like Protein 3; anti-ARL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARL3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Applicable Applications for anti-ARL3 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ARL3, aa1-182 (NP_004302.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ARL3 expression in transfected 293T cell line by ARL3 polyclonal antibody. Lane 1: ARL3 transfected lysate (20.02kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARL3 expression in transfected 293T cell line by ARL3 polyclonal antibody. Lane 1: ARL3 transfected lysate (20.02kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ARL3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to ARL3 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-ARL3 antibody
ADP-ribosylation factors (ARFs) are low molecular weight GTP-binding proteins belonging to the RAS superfamily. The predicted 182aa ARL3 (ADP-ribosylation like factor) protein shares 97% amino acid identity with rat ARLl3 and 43% identity with human ARF1. Like the ARFs, ARL3 has a glycine at position 2, the site of N myristoylation, and lacks cysteine residues near the C terminus, which are found in other members of the RAS family. Northern blot analysis detected a 1-kb ARL3 transcript in all tissues tested, with highest expression in heart and lung, and lower expression in brain, liver, kidney, ovary, and testis. A 5.5-kb transcript was also detected in most tissues, with highest expression in brain. Immunoblot analysis detected ARL3 in human tumor cell lines but not in normal rodent cells. Although ARL3 binds GTP, it is devoid of activity in the cholera toxin-dependent ADP-ribosylation of Gs, and is therefore classified as an ARF-like protein.
Product Categories/Family for anti-ARL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
403
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,456 Da
NCBI Official Full Name
ADP-ribosylation factor-like protein 3
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 3
NCBI Official Symbol
ARL3
NCBI Official Synonym Symbols
ARFL3
NCBI Protein Information
ADP-ribosylation factor-like protein 3; ARF-like 3
UniProt Protein Name
ADP-ribosylation factor-like protein 3
UniProt Gene Name
ARL3
UniProt Synonym Gene Names
ARFL3
UniProt Entry Name
ARL3_HUMAN

NCBI Description

ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Requires assistance from GTPase-activating proteins (GAPs) like RP2 and PDE6D, in order to cycle between inactive GDP-bound and active GTP-bound forms. Required for targeting proteins such as NPHP3 to the ciliary membrane by releasing myristoylated NPHP3 from UNC119B cargo adapter into the cilium. Does not act as an allosteric activator of the cholera toxin catalytic subunit. Ref.13 Ref.15 Ref.18

Subunit structure: Interacts with RP2. The GTP-bound form interacts with PDE6D. Found in a complex with ARL3, RP2 and UNC119 (or UNC119B); RP2 induces hydrolysis of GTP ARL3 in the complex, leading to the release of UNC119 (or UNC119B). Interacts with SYS1. The GTP-bound form interacts with ARL2BP and PDE6D. Interacts with RP2; interaction is direct and stimulated with the activated GTP-bound form of ARL3. Microtubule-associated protein. Does not interact with TBCC. May interact with GOLGA4. Ref.8 Ref.9 Ref.11 Ref.12 Ref.14 Ref.15

Subcellular location: Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › cytoskeleton › spindle. Nucleus. Cytoplasm › cytoskeleton › microtubule organizing center › centrosome. Cytoplasm. Cell projection › cilium. Note: Detected predominantly in the photoreceptor connecting cilium. Present on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Ref.10 Ref.12 Ref.13 Ref.15

Tissue specificity: Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level). Ref.10

Sequence similarities: Belongs to the small GTPase superfamily. Arf family.

Research Articles on ARL3

Similar Products

Product Notes

The ARL3 arl3 (Catalog #AAA648628) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARL3 (ADP-ribosylation Factor-like Protein 3, ARFL3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ARL3 arl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLLSILRKL KSAPDQEVRI LLLGLDNAGK TTLLKQLASE DISHITPTQG FNIKSVQSQG FKLNVWDIGG QRKIRPYWKN YFENTDILIY VIDSADRKRF EETGQELAEL LEEEKLSCVP VLIFANKQDL LTAAPASEIA EGLNLHTIRD RVWQIQSCSA LTGEGVQDGM NWVCKNVNAK KK. It is sometimes possible for the material contained within the vial of "ARL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.