Mouse anti-Human QPCT Polyclonal Antibody | anti-Qpct antibody

QPCT (Glutaminyl-peptide Cyclotransferase, Glutaminyl Cyclase, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase)

Cat. Num. AAA648239

• Gene Names: Qpct; 5730422A13Rik
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: QPCT; Polyclonal Antibody; QPCT (Glutaminyl-peptide Cyclotransferase; Glutaminyl Cyclase; Glutaminyl-tRNA Cyclotransferase; Glutamyl Cyclase); Anti -QPCT (Glutaminyl-peptide Cyclotransferase; anti-Qpct antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human QPCT.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

• Applicable Applications for anti-Qpct antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human QPCT, aa1-361 (NP_036545.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(QPCT polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of QPCT expression in transfected 293T cell line by QPCT polyclonal antibody. Lane 1: QPCT transfected lysate (39.71kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-Qpct antibody

This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase.

Product Categories/Family for anti-Qpct antibody

Antibodies; Abs to Enzymes; Cyclase

NCBI and Uniprot Product Information

• NCBI GI #: 18043218
• NCBI GeneID: 70536
• UniProt Accession #: Q9CYK2; Q8BH20; Q8VE07
• Molecular Weight: 41,119 Da
• NCBI Official Full Name: Qpct protein
• NCBI Official Synonym Full Names: glutaminyl-peptide cyclotransferase (glutaminyl cyclase)
• NCBI Official Symbol: Qpct
• NCBI Official Synonym Symbols: 5730422A13Rik
• NCBI Protein Information: glutaminyl-peptide cyclotransferase; QC; glutaminyl cyclase; glutaminyl-tRNA cyclotransferase
• UniProt Protein Name: Glutaminyl-peptide cyclotransferase
• UniProt Gene Name: Qpct
• UniProt Synonym Gene Names: QC
• UniProt Entry Name: QPCT_MOUSE

Uniprot Description

Function: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue

By similarity.

Catalytic activity: L-glutaminyl-peptide = 5-oxoprolyl-peptide + NH3.

Cofactor: Binds 1 zinc ion per subunit

By similarity.

Subcellular location: Secreted

By similarity.

Sequence similarities: Belongs to the glutaminyl-peptide cyclotransferase family.