Western Blot (WB)
(CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431.)
Rabbit anti-Human CDC42EP3 Polyclonal Antibody | anti-CDC42EP3 antibody
CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (APC)
Gene Names
CDC42EP3; UB1; CEP3; BORG2
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
CDC42EP3; Polyclonal Antibody; CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3; BORG2; CEP3; FLJ46903; UB1) (APC); CDC42 Effector Protein (Rho GTPase Binding) 3; UB1; anti-CDC42EP3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDC42EP3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CDC42EP3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CDC42EP3 (NP_006440.2, 1aa-254aa) full-length human protein.
Immunogen Sequence
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431.)
Western Blot (WB)
(CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431.)
Western Blot (WB)
(Western Blot analysis of CDC42EP3 expression in transfected 293T cell line by CDC42EP3 MaxPab polyclonal antibody.Lane 1: CDC42EP3 transfected lysate(27.70 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CDC42EP3 expression in transfected 293T cell line by CDC42EP3 MaxPab polyclonal antibody.Lane 1: CDC42EP3 transfected lysate(27.70 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-CDC42EP3 antibody
CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq]
Product Categories/Family for anti-CDC42EP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,678 Da
NCBI Official Full Name
cdc42 effector protein 3
NCBI Official Synonym Full Names
CDC42 effector protein (Rho GTPase binding) 3
NCBI Official Symbol
CDC42EP3
NCBI Official Synonym Symbols
UB1; CEP3; BORG2
NCBI Protein Information
cdc42 effector protein 3; MSE55-related protein; binder of Rho GTPases 2; CRIB-containing BORG2 protein; MSE55-related Cdc42-binding protein
UniProt Protein Name
Cdc42 effector protein 3
Protein Family
UniProt Gene Name
CDC42EP3
UniProt Synonym Gene Names
BORG2; CEP3
UniProt Entry Name
BORG2_HUMAN
Uniprot Description
CDC42EP3: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts. Belongs to the BORG/CEP family.
Protein type: G protein regulator, misc.
Chromosomal Location of Human Ortholog: 2p21
Cellular Component: cytoplasm; plasma membrane; endomembrane system; actin cytoskeleton
Molecular Function: GTP-Rho binding; cytoskeletal regulatory protein binding
Biological Process: regulation of cell shape; positive regulation of pseudopodium formation; positive regulation of actin filament polymerization; signal transduction; Rho protein signal transduction
Similar Products
Product Notes
The CDC42EP3 cdc42ep3 (Catalog #AAA6450663) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42EP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC42EP3 cdc42ep3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC42EP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
