Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of THAP10 expression in transfected 293T cell line by THAP10 polyclonal antibody. Lane 1: THAP10 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human THAP10 Polyclonal Antibody | anti-THAP10 antibody

THAP10 (THAP Domain-containing Protein 10)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
THAP10; Polyclonal Antibody; THAP10 (THAP Domain-containing Protein 10); Anti -THAP10 (THAP Domain-containing Protein 10); anti-THAP10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human THAP10.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAAASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATTQTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEETC
Applicable Applications for anti-THAP10 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human THAP10, aa1-257 (NP_064532.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of THAP10 expression in transfected 293T cell line by THAP10 polyclonal antibody. Lane 1: THAP10 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of THAP10 expression in transfected 293T cell line by THAP10 polyclonal antibody. Lane 1: THAP10 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-THAP10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,351 Da
NCBI Official Full Name
THAP domain-containing protein 10
NCBI Official Synonym Full Names
THAP domain containing 10
NCBI Official Symbol
THAP10
NCBI Protein Information
THAP domain-containing protein 10
UniProt Protein Name
THAP domain-containing protein 10
UniProt Gene Name
THAP10
UniProt Entry Name
THA10_HUMAN

NCBI Description

This gene encodes a member of a family of proteins sharing an N-terminal Thanatos-associated domain. The Thanatos-associated domain contains a zinc finger signature similar to DNA-binding domains. This gene is part of a bidirectional gene pair on the long arm of chromosome 15 that is regulated by estrogen and may play a role in breast cancer. [provided by RefSeq, Nov 2010]

Uniprot Description

THAP10:

Chromosomal Location of Human Ortholog: 15q23

Molecular Function: DNA binding; metal ion binding

Research Articles on THAP10

Similar Products

Product Notes

The THAP10 thap10 (Catalog #AAA644955) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The THAP10 (THAP Domain-containing Protein 10) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THAP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the THAP10 thap10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPARCVAAHC GNTTKSGKSL FRFPKDRAVR LLWDRFVRGC RADWYGGNDR SVICSDHFAP ACFDVSSVIQ KNLRFSQRLR LVAGAVPTLH RVPAPAPKRG EEGDQAGRLD TRGELQAARH SEAAPGPVSC TRPRAGKQAA ASQITCENEL VQTQPHADNP SNTVTSVPTH CEEGPVHKST QISLKRPRHR SVGIQAKVKA FGKRLCNATT QTEELWSRTS SLFDIYSSDS ETDTDWDIKS EQSDLSYMAV QVKEETC. It is sometimes possible for the material contained within the vial of "THAP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.